Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0QA49

Protein Details
Accession A0A5B0QA49   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-46RDPFANKRPSARKNIGANRRPPHPSNPNQNSSRKQHydrophilic
NLS Segment(s)
PositionSequence
18-34KRPSARKNIGANRRPPH
Subcellular Location(s) cyto 5, cyto_nucl 12.5, mito 4, nucl 18
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MSTTTTNLQESRDPFANKRPSARKNIGANRRPPHPSNPNQNSSRKQTKAPASGGSNPKKSSSHGALDFIDTLDTIGGFHHDGPFDAASSHRNRHMNSKNPSRQAPMAAFDPSALILPPPPPASAPAPVSLASQDHVYPPAIPRRASDNTMPVSMGYPAGTIAADPKAARLAEAFGIQGKEAWEDFGMEHAIEEGSTGGGGLLGHRRGTSREQRDAKSASVWDMEETLKSGKPVPSAYTPRSEASARGANGELERQATNAAQLKRSKSLMQRIKKGVKSPNLPMEMPPSPISGDPNEYEELRSDPPSTSQLPPSSPIGRKASLLHKFGLVKRSNTRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.48
3 0.55
4 0.53
5 0.61
6 0.64
7 0.65
8 0.71
9 0.75
10 0.74
11 0.75
12 0.81
13 0.82
14 0.8
15 0.82
16 0.77
17 0.76
18 0.75
19 0.68
20 0.68
21 0.68
22 0.69
23 0.71
24 0.74
25 0.76
26 0.76
27 0.8
28 0.77
29 0.76
30 0.77
31 0.68
32 0.65
33 0.65
34 0.67
35 0.67
36 0.63
37 0.6
38 0.55
39 0.6
40 0.65
41 0.63
42 0.6
43 0.53
44 0.53
45 0.48
46 0.46
47 0.46
48 0.42
49 0.41
50 0.38
51 0.39
52 0.37
53 0.37
54 0.34
55 0.26
56 0.2
57 0.13
58 0.11
59 0.07
60 0.06
61 0.05
62 0.04
63 0.06
64 0.06
65 0.07
66 0.09
67 0.09
68 0.09
69 0.12
70 0.12
71 0.11
72 0.1
73 0.11
74 0.14
75 0.19
76 0.21
77 0.25
78 0.29
79 0.3
80 0.4
81 0.48
82 0.53
83 0.57
84 0.65
85 0.67
86 0.68
87 0.7
88 0.64
89 0.57
90 0.52
91 0.45
92 0.36
93 0.3
94 0.26
95 0.23
96 0.18
97 0.16
98 0.12
99 0.1
100 0.08
101 0.06
102 0.06
103 0.06
104 0.09
105 0.09
106 0.09
107 0.1
108 0.12
109 0.15
110 0.17
111 0.18
112 0.17
113 0.17
114 0.17
115 0.17
116 0.15
117 0.13
118 0.1
119 0.09
120 0.09
121 0.08
122 0.09
123 0.09
124 0.09
125 0.12
126 0.18
127 0.2
128 0.2
129 0.2
130 0.26
131 0.29
132 0.3
133 0.29
134 0.27
135 0.27
136 0.27
137 0.26
138 0.19
139 0.17
140 0.14
141 0.12
142 0.07
143 0.05
144 0.05
145 0.05
146 0.05
147 0.04
148 0.05
149 0.05
150 0.06
151 0.05
152 0.06
153 0.07
154 0.07
155 0.08
156 0.07
157 0.07
158 0.07
159 0.08
160 0.08
161 0.07
162 0.07
163 0.07
164 0.08
165 0.07
166 0.07
167 0.07
168 0.07
169 0.06
170 0.06
171 0.06
172 0.07
173 0.07
174 0.06
175 0.06
176 0.05
177 0.05
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.02
185 0.03
186 0.03
187 0.04
188 0.07
189 0.08
190 0.08
191 0.09
192 0.09
193 0.12
194 0.19
195 0.28
196 0.32
197 0.41
198 0.47
199 0.48
200 0.53
201 0.52
202 0.46
203 0.39
204 0.33
205 0.25
206 0.21
207 0.2
208 0.15
209 0.14
210 0.13
211 0.11
212 0.11
213 0.12
214 0.11
215 0.11
216 0.14
217 0.15
218 0.17
219 0.18
220 0.2
221 0.27
222 0.32
223 0.34
224 0.35
225 0.36
226 0.34
227 0.36
228 0.33
229 0.26
230 0.25
231 0.29
232 0.24
233 0.23
234 0.23
235 0.21
236 0.21
237 0.22
238 0.17
239 0.13
240 0.13
241 0.11
242 0.12
243 0.11
244 0.15
245 0.2
246 0.21
247 0.25
248 0.29
249 0.32
250 0.36
251 0.38
252 0.4
253 0.4
254 0.49
255 0.54
256 0.58
257 0.63
258 0.69
259 0.75
260 0.74
261 0.74
262 0.72
263 0.71
264 0.69
265 0.67
266 0.67
267 0.62
268 0.58
269 0.52
270 0.5
271 0.43
272 0.4
273 0.33
274 0.26
275 0.23
276 0.23
277 0.25
278 0.2
279 0.23
280 0.2
281 0.23
282 0.23
283 0.23
284 0.23
285 0.21
286 0.22
287 0.21
288 0.22
289 0.2
290 0.19
291 0.21
292 0.25
293 0.28
294 0.28
295 0.31
296 0.33
297 0.34
298 0.36
299 0.39
300 0.42
301 0.42
302 0.45
303 0.45
304 0.43
305 0.43
306 0.45
307 0.49
308 0.49
309 0.49
310 0.43
311 0.43
312 0.47
313 0.5
314 0.54
315 0.49
316 0.48