Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0LKT0

Protein Details
Accession A0A5B0LKT0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-60FKPSRNQWKPLKPKKYRLRNQRKSNLVAHydrophilic
NLS Segment(s)
PositionSequence
37-53RNQWKPLKPKKYRLRNQ
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MAMVNTPLQPSSTFPSQPTRPLSLRLPSITKLFKPSRNQWKPLKPKKYRLRNQRKSNLVAPVLKQSEFEMTAFFVLDPPMNQRNQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.33
3 0.35
4 0.4
5 0.42
6 0.42
7 0.38
8 0.41
9 0.43
10 0.4
11 0.41
12 0.37
13 0.35
14 0.31
15 0.34
16 0.33
17 0.29
18 0.33
19 0.34
20 0.38
21 0.42
22 0.49
23 0.56
24 0.59
25 0.65
26 0.66
27 0.71
28 0.75
29 0.78
30 0.8
31 0.75
32 0.8
33 0.83
34 0.86
35 0.85
36 0.85
37 0.87
38 0.86
39 0.9
40 0.88
41 0.84
42 0.79
43 0.74
44 0.69
45 0.62
46 0.54
47 0.45
48 0.44
49 0.39
50 0.34
51 0.3
52 0.25
53 0.24
54 0.22
55 0.21
56 0.14
57 0.12
58 0.13
59 0.13
60 0.11
61 0.09
62 0.08
63 0.09
64 0.09
65 0.15
66 0.2