Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0P287

Protein Details
Accession A0A5B0P287   
Localization Confidence Low
Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-61VSSHHNARKRQPKKIIYRSSINKRVTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7, cyto_mito 9.833, cyto_nucl 5.333, extr 4, mito 11.5, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MRLSVTDGLSGLLGCPCALVFKSCEGLVFESVEEQVSSHHNARKRQPKKIIYRSSINKRVTGDQGVCSVCWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.07
5 0.07
6 0.08
7 0.09
8 0.11
9 0.13
10 0.13
11 0.14
12 0.14
13 0.15
14 0.14
15 0.13
16 0.11
17 0.09
18 0.1
19 0.09
20 0.07
21 0.05
22 0.05
23 0.07
24 0.1
25 0.12
26 0.16
27 0.2
28 0.25
29 0.35
30 0.45
31 0.49
32 0.56
33 0.63
34 0.7
35 0.76
36 0.82
37 0.82
38 0.77
39 0.8
40 0.8
41 0.81
42 0.8
43 0.72
44 0.65
45 0.58
46 0.58
47 0.53
48 0.5
49 0.42
50 0.35
51 0.38
52 0.35