Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0PEQ2

Protein Details
Accession A0A5B0PEQ2   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
21-44SIETNDKPKTKRKGKRHLNDTPDLHydrophilic
NLS Segment(s)
PositionSequence
28-36PKTKRKGKR
Subcellular Location(s) cyto_nucl 14.5, nucl 23
Family & Domain DBs
Amino Acid Sequences MHHQPETETSVATDEEEVNVSIETNDKPKTKRKGKRHLNDTPDLLRVYSTSLHAALIMYTPSGLSCKMRLRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.09
6 0.09
7 0.08
8 0.07
9 0.09
10 0.09
11 0.11
12 0.15
13 0.18
14 0.22
15 0.3
16 0.41
17 0.49
18 0.58
19 0.66
20 0.73
21 0.8
22 0.87
23 0.87
24 0.85
25 0.81
26 0.75
27 0.68
28 0.59
29 0.5
30 0.41
31 0.31
32 0.23
33 0.17
34 0.14
35 0.12
36 0.11
37 0.1
38 0.1
39 0.1
40 0.1
41 0.1
42 0.08
43 0.08
44 0.07
45 0.06
46 0.05
47 0.05
48 0.06
49 0.07
50 0.08
51 0.1
52 0.15
53 0.23