Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0M347

Protein Details
Accession A0A5B0M347    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-94QEERERKEKEKKDREEKEKKEKKEKEEREKKEKERKEKEEABasic
NLS Segment(s)
PositionSequence
42-91RKRRAIIARKLEQEERERKEKEKKDREEKEKKEKKEKEEREKKEKERKEK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MQKDLVTISREHLALMNTTKDDVIMSKDLSSMDEEARAYYQRKRRAIIARKLEQEERERKEKEKKDREEKEKKEKKEKEEREKKEKERKEKEEAEEEEDDNEENDGQNNYDGKNDSDGENNSDGENNDNGDAEEENEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.21
4 0.18
5 0.19
6 0.18
7 0.16
8 0.15
9 0.13
10 0.14
11 0.14
12 0.14
13 0.14
14 0.15
15 0.15
16 0.15
17 0.16
18 0.14
19 0.12
20 0.13
21 0.12
22 0.12
23 0.13
24 0.15
25 0.16
26 0.21
27 0.28
28 0.35
29 0.39
30 0.4
31 0.47
32 0.55
33 0.62
34 0.64
35 0.66
36 0.64
37 0.65
38 0.66
39 0.61
40 0.55
41 0.53
42 0.52
43 0.47
44 0.48
45 0.45
46 0.47
47 0.54
48 0.58
49 0.61
50 0.63
51 0.67
52 0.71
53 0.78
54 0.83
55 0.84
56 0.84
57 0.84
58 0.82
59 0.8
60 0.8
61 0.77
62 0.75
63 0.76
64 0.78
65 0.78
66 0.81
67 0.82
68 0.82
69 0.84
70 0.85
71 0.85
72 0.83
73 0.82
74 0.82
75 0.8
76 0.79
77 0.77
78 0.72
79 0.7
80 0.64
81 0.59
82 0.5
83 0.44
84 0.36
85 0.29
86 0.24
87 0.16
88 0.14
89 0.08
90 0.07
91 0.08
92 0.08
93 0.08
94 0.1
95 0.11
96 0.11
97 0.14
98 0.16
99 0.15
100 0.18
101 0.19
102 0.18
103 0.22
104 0.23
105 0.25
106 0.25
107 0.24
108 0.21
109 0.22
110 0.21
111 0.19
112 0.19
113 0.16
114 0.14
115 0.14
116 0.14
117 0.13
118 0.13