Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0QET0

Protein Details
Accession A0A5B0QET0   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-36AASKTLPKKQTVKPKKIKARLIKVLDDHydrophilic
NLS Segment(s)
PositionSequence
16-30PKKQTVKPKKIKARL
70-84KPTKEPHKGGPAKKK
Subcellular Location(s) cyto_nucl 13.5, nucl 23
Family & Domain DBs
Amino Acid Sequences MPPKSTTKLAASKTLPKKQTVKPKKIKARLIKVLDDEVNKKGEIPSKKTKLDVQEEDKQKSQPSKNSTDKPTKEPHKGGPAKKKVPANDDSEKEEASKRAPNYKDDKDIELCRSWLEITKDQLNLTNKKVPPNDDSDKEEASKRAPNYKDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.61
3 0.6
4 0.65
5 0.65
6 0.72
7 0.72
8 0.74
9 0.76
10 0.83
11 0.87
12 0.89
13 0.9
14 0.89
15 0.89
16 0.87
17 0.82
18 0.76
19 0.67
20 0.62
21 0.56
22 0.49
23 0.41
24 0.33
25 0.3
26 0.25
27 0.23
28 0.21
29 0.25
30 0.27
31 0.32
32 0.4
33 0.45
34 0.47
35 0.49
36 0.51
37 0.51
38 0.53
39 0.53
40 0.49
41 0.51
42 0.54
43 0.55
44 0.53
45 0.46
46 0.42
47 0.42
48 0.4
49 0.39
50 0.4
51 0.45
52 0.51
53 0.56
54 0.59
55 0.61
56 0.59
57 0.57
58 0.6
59 0.57
60 0.56
61 0.53
62 0.5
63 0.51
64 0.55
65 0.57
66 0.59
67 0.62
68 0.59
69 0.61
70 0.61
71 0.54
72 0.53
73 0.5
74 0.47
75 0.44
76 0.42
77 0.41
78 0.38
79 0.35
80 0.31
81 0.28
82 0.22
83 0.19
84 0.22
85 0.2
86 0.27
87 0.29
88 0.34
89 0.4
90 0.44
91 0.49
92 0.46
93 0.48
94 0.45
95 0.47
96 0.44
97 0.38
98 0.34
99 0.26
100 0.25
101 0.21
102 0.21
103 0.24
104 0.24
105 0.27
106 0.31
107 0.32
108 0.32
109 0.38
110 0.39
111 0.37
112 0.38
113 0.42
114 0.4
115 0.47
116 0.5
117 0.48
118 0.46
119 0.5
120 0.53
121 0.49
122 0.53
123 0.49
124 0.48
125 0.46
126 0.45
127 0.38
128 0.35
129 0.37
130 0.36
131 0.4