Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0QPL0

Protein Details
Accession A0A5B0QPL0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-75TKEAHPSRTQSNKKKKKKKNRFKLASGNRILPHydrophilic
NLS Segment(s)
PositionSequence
54-67SNKKKKKKKNRFKL
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MERDGDKKDVNPNKRTHGRKQVHGTSVSLVARRSSSSNPTTTATKEAHPSRTQSNKKKKKKKNRFKLASGNRILPWSKHFINLQTTPSSES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.72
4 0.74
5 0.72
6 0.73
7 0.77
8 0.75
9 0.7
10 0.65
11 0.57
12 0.47
13 0.45
14 0.37
15 0.29
16 0.22
17 0.18
18 0.17
19 0.17
20 0.17
21 0.15
22 0.2
23 0.21
24 0.22
25 0.24
26 0.25
27 0.25
28 0.24
29 0.25
30 0.2
31 0.19
32 0.23
33 0.24
34 0.26
35 0.26
36 0.28
37 0.31
38 0.4
39 0.48
40 0.52
41 0.61
42 0.67
43 0.77
44 0.85
45 0.89
46 0.91
47 0.93
48 0.94
49 0.94
50 0.95
51 0.93
52 0.91
53 0.91
54 0.9
55 0.88
56 0.8
57 0.73
58 0.62
59 0.58
60 0.5
61 0.41
62 0.35
63 0.32
64 0.3
65 0.3
66 0.32
67 0.33
68 0.39
69 0.41
70 0.4
71 0.36