Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1V1H1

Protein Details
Accession H1V1H1    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MKEAKTKKHVDRRASKGRKMRFNVBasic
NLS Segment(s)
PositionSequence
5-20KTKKHVDRRASKGRKM
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039223  AATF/Bfr2  
IPR012617  AATF_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08164  TRAUB  
Amino Acid Sequences MKEAKTKKHVDRRASKGRKMRFNVHEKLQNFMAPEDRRAWEQDAASDAEMEDDEEVDAEEAGLRLFRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.81
4 0.81
5 0.8
6 0.76
7 0.76
8 0.74
9 0.74
10 0.71
11 0.68
12 0.67
13 0.58
14 0.55
15 0.46
16 0.38
17 0.3
18 0.26
19 0.26
20 0.19
21 0.2
22 0.2
23 0.2
24 0.19
25 0.21
26 0.23
27 0.18
28 0.18
29 0.17
30 0.17
31 0.17
32 0.16
33 0.14
34 0.11
35 0.09
36 0.09
37 0.08
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.05
47 0.05
48 0.05