Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0P7K3

Protein Details
Accession A0A5B0P7K3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MIILKKRSRCRHIGVSNKKPVAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, mito 16
Family & Domain DBs
Amino Acid Sequences MIILKKRSRCRHIGVSNKKPVALTVDSVGISKHDVGIDICQAHAMHASSCSTRRIIATVAAHRNGWRVSETTKYRIILFKTLRADCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.83
4 0.76
5 0.69
6 0.58
7 0.49
8 0.44
9 0.35
10 0.26
11 0.18
12 0.18
13 0.18
14 0.17
15 0.17
16 0.11
17 0.1
18 0.08
19 0.08
20 0.06
21 0.07
22 0.07
23 0.08
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.08
30 0.08
31 0.07
32 0.06
33 0.07
34 0.08
35 0.08
36 0.1
37 0.11
38 0.11
39 0.11
40 0.12
41 0.12
42 0.12
43 0.16
44 0.19
45 0.24
46 0.28
47 0.29
48 0.29
49 0.28
50 0.3
51 0.26
52 0.23
53 0.18
54 0.16
55 0.17
56 0.26
57 0.3
58 0.31
59 0.35
60 0.35
61 0.36
62 0.4
63 0.4
64 0.41
65 0.4
66 0.43
67 0.46