Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0P515

Protein Details
Accession A0A5B0P515    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
2-25RITHHSTLRRCKSKYKVKLASDALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.166, cyto_nucl 4.333, nucl 4
Family & Domain DBs
Amino Acid Sequences MRITHHSTLRRCKSKYKVKLASDALVTTRKNVSPLTLARSTGSSYVKEMRLCPPAPGLGEPLRLLSGVGMDYQAAFSSYVSSNVLPPLFRRKGESEGTGPEQGEWRRSGAKAGGEKDQDDII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.81
4 0.8
5 0.75
6 0.81
7 0.75
8 0.68
9 0.58
10 0.49
11 0.4
12 0.36
13 0.31
14 0.25
15 0.24
16 0.21
17 0.22
18 0.21
19 0.2
20 0.21
21 0.23
22 0.26
23 0.25
24 0.25
25 0.24
26 0.24
27 0.23
28 0.21
29 0.21
30 0.15
31 0.16
32 0.19
33 0.21
34 0.22
35 0.22
36 0.23
37 0.27
38 0.26
39 0.25
40 0.22
41 0.2
42 0.2
43 0.18
44 0.18
45 0.13
46 0.14
47 0.13
48 0.12
49 0.11
50 0.1
51 0.1
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.07
65 0.07
66 0.08
67 0.09
68 0.1
69 0.1
70 0.12
71 0.12
72 0.1
73 0.12
74 0.21
75 0.24
76 0.24
77 0.29
78 0.3
79 0.35
80 0.39
81 0.41
82 0.34
83 0.36
84 0.4
85 0.37
86 0.33
87 0.28
88 0.3
89 0.28
90 0.28
91 0.24
92 0.23
93 0.24
94 0.24
95 0.28
96 0.26
97 0.31
98 0.35
99 0.36
100 0.41
101 0.4
102 0.4