Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0M3H7

Protein Details
Accession A0A5B0M3H7   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-68PIAIVKAPAKRKKRNTPNKPNKPNKPSEPNTHydrophilic
NLS Segment(s)
PositionSequence
28-62KGFRKRASRDPIAIVKAPAKRKKRNTPNKPNKPNK
Subcellular Location(s) E.R. 4, cyto_pero 2, extr 9, golg 2, mito 2, mito_nucl 2, nucl 2, pero 3, plas 3
Family & Domain DBs
Amino Acid Sequences MRLLLIVAALIPFAYLLEPERQLQPDGKGFRKRASRDPIAIVKAPAKRKKRNTPNKPNKPNKPSEPNTSPINLGPGFLQRPHKDDTIYTLYSGADGYYTEMFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.06
4 0.1
5 0.12
6 0.14
7 0.17
8 0.18
9 0.2
10 0.22
11 0.24
12 0.28
13 0.32
14 0.37
15 0.42
16 0.43
17 0.47
18 0.53
19 0.54
20 0.56
21 0.59
22 0.57
23 0.52
24 0.55
25 0.53
26 0.48
27 0.45
28 0.37
29 0.33
30 0.33
31 0.38
32 0.41
33 0.45
34 0.51
35 0.59
36 0.69
37 0.75
38 0.81
39 0.84
40 0.88
41 0.91
42 0.93
43 0.94
44 0.93
45 0.92
46 0.89
47 0.86
48 0.82
49 0.81
50 0.74
51 0.72
52 0.66
53 0.6
54 0.55
55 0.48
56 0.41
57 0.31
58 0.31
59 0.22
60 0.18
61 0.15
62 0.17
63 0.17
64 0.2
65 0.27
66 0.25
67 0.29
68 0.32
69 0.33
70 0.31
71 0.3
72 0.33
73 0.32
74 0.31
75 0.28
76 0.25
77 0.23
78 0.21
79 0.21
80 0.13
81 0.07
82 0.06
83 0.09