Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0S3A9

Protein Details
Accession A0A5B0S3A9   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
39-66RHSPEGNKKGKKKPSKTRKPPIDKTSSPBasic
NLS Segment(s)
PositionSequence
44-59GNKKGKKKPSKTRKPP
Subcellular Location(s) cyto 6, cyto_nucl 14.5, nucl 21
Family & Domain DBs
Amino Acid Sequences MDDEEAYSTSVPDFKHPTLLGYSSHASISPLSLVGFVSRHSPEGNKKGKKKPSKTRKPPIDKTSSPLNPALDSYQLRPSTSNPATTNTTTTTNITHTSTDNINTHLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.27
4 0.28
5 0.28
6 0.29
7 0.26
8 0.24
9 0.24
10 0.19
11 0.19
12 0.17
13 0.15
14 0.13
15 0.13
16 0.09
17 0.08
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.1
25 0.1
26 0.11
27 0.11
28 0.15
29 0.2
30 0.3
31 0.39
32 0.43
33 0.51
34 0.59
35 0.68
36 0.74
37 0.78
38 0.8
39 0.82
40 0.85
41 0.88
42 0.9
43 0.91
44 0.91
45 0.9
46 0.86
47 0.84
48 0.73
49 0.66
50 0.65
51 0.56
52 0.49
53 0.42
54 0.35
55 0.27
56 0.27
57 0.24
58 0.19
59 0.18
60 0.18
61 0.23
62 0.23
63 0.23
64 0.23
65 0.24
66 0.3
67 0.3
68 0.34
69 0.28
70 0.31
71 0.36
72 0.36
73 0.36
74 0.29
75 0.31
76 0.26
77 0.26
78 0.24
79 0.22
80 0.23
81 0.23
82 0.22
83 0.2
84 0.21
85 0.23
86 0.26
87 0.25