Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W5G0

Protein Details
Accession H1W5G0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
130-159LYGDRRTHRLTKRRKPKRYPRPRLFPRLWLBasic
NLS Segment(s)
PositionSequence
134-152RRTHRLTKRRKPKRYPRPR
Subcellular Location(s) plas 13, mito 6, nucl 5, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG chig:CH63R_04668  -  
Amino Acid Sequences MGYPTFSSAQAQGTASDSRHGTQGSVRQVKEVTMLLTNRRDTNIMQARLFVCQRREKERERWTMLTALFIGSTCQMSRSEAEFPLSQTNLTLFHVPRYYFWILPAPTPRSVTSYRRQRWRGHLLKMPNTLYGDRRTHRLTKRRKPKRYPRPRLFPRLWLLRALVASFLYYILFIRWSFWPLLGTGTGIRVESLDCLVELTRGATVGSWDGAGSWDSGRTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.21
4 0.2
5 0.19
6 0.21
7 0.2
8 0.18
9 0.21
10 0.27
11 0.34
12 0.4
13 0.39
14 0.38
15 0.39
16 0.38
17 0.36
18 0.3
19 0.22
20 0.19
21 0.21
22 0.24
23 0.29
24 0.31
25 0.3
26 0.3
27 0.3
28 0.25
29 0.34
30 0.38
31 0.36
32 0.34
33 0.36
34 0.35
35 0.37
36 0.39
37 0.33
38 0.3
39 0.34
40 0.39
41 0.44
42 0.51
43 0.53
44 0.6
45 0.66
46 0.69
47 0.68
48 0.66
49 0.59
50 0.58
51 0.51
52 0.42
53 0.32
54 0.23
55 0.16
56 0.13
57 0.12
58 0.07
59 0.08
60 0.06
61 0.07
62 0.08
63 0.09
64 0.11
65 0.13
66 0.15
67 0.14
68 0.17
69 0.16
70 0.17
71 0.19
72 0.18
73 0.15
74 0.13
75 0.13
76 0.11
77 0.11
78 0.13
79 0.1
80 0.13
81 0.15
82 0.15
83 0.15
84 0.2
85 0.21
86 0.18
87 0.19
88 0.22
89 0.2
90 0.22
91 0.26
92 0.23
93 0.22
94 0.24
95 0.24
96 0.22
97 0.26
98 0.28
99 0.33
100 0.4
101 0.45
102 0.52
103 0.57
104 0.58
105 0.62
106 0.68
107 0.66
108 0.61
109 0.61
110 0.58
111 0.6
112 0.59
113 0.51
114 0.43
115 0.38
116 0.33
117 0.3
118 0.3
119 0.29
120 0.25
121 0.29
122 0.31
123 0.38
124 0.45
125 0.51
126 0.57
127 0.62
128 0.72
129 0.79
130 0.86
131 0.88
132 0.91
133 0.93
134 0.94
135 0.95
136 0.94
137 0.94
138 0.92
139 0.91
140 0.83
141 0.8
142 0.76
143 0.73
144 0.64
145 0.54
146 0.46
147 0.38
148 0.35
149 0.28
150 0.21
151 0.12
152 0.11
153 0.09
154 0.08
155 0.06
156 0.06
157 0.06
158 0.05
159 0.07
160 0.07
161 0.09
162 0.1
163 0.13
164 0.13
165 0.14
166 0.14
167 0.13
168 0.15
169 0.13
170 0.13
171 0.11
172 0.12
173 0.12
174 0.11
175 0.11
176 0.09
177 0.09
178 0.09
179 0.09
180 0.08
181 0.07
182 0.08
183 0.08
184 0.09
185 0.08
186 0.08
187 0.07
188 0.07
189 0.07
190 0.07
191 0.08
192 0.09
193 0.09
194 0.08
195 0.08
196 0.08
197 0.09
198 0.09
199 0.09
200 0.08