Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0R1N8

Protein Details
Accession A0A5B0R1N8   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-42QGTARFNRPRPYLRRRRRCRRIEYRPVIEGHydrophilic
NLS Segment(s)
PositionSequence
25-30LRRRRR
Subcellular Location(s) cyto 7, cyto_nucl 10.333, mito 6.5, mito_nucl 9.666, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MLTGTEWELGVVQGTARFNRPRPYLRRRRRCRRIEYRPVIEGQRRQQVVRSYGLIAPVSPSSDRAPRLFLLPSRYPVPPYPIPLPFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.17
4 0.22
5 0.25
6 0.33
7 0.38
8 0.44
9 0.52
10 0.61
11 0.67
12 0.74
13 0.82
14 0.85
15 0.9
16 0.92
17 0.93
18 0.92
19 0.92
20 0.92
21 0.92
22 0.9
23 0.83
24 0.75
25 0.67
26 0.6
27 0.53
28 0.47
29 0.41
30 0.39
31 0.35
32 0.33
33 0.35
34 0.36
35 0.34
36 0.31
37 0.27
38 0.23
39 0.22
40 0.24
41 0.19
42 0.14
43 0.13
44 0.12
45 0.12
46 0.1
47 0.12
48 0.13
49 0.17
50 0.2
51 0.19
52 0.22
53 0.21
54 0.24
55 0.25
56 0.25
57 0.29
58 0.3
59 0.33
60 0.33
61 0.34
62 0.35
63 0.35
64 0.39
65 0.36
66 0.38
67 0.41