Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0PAS1

Protein Details
Accession A0A5B0PAS1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MARETRSKRKRPNPIIQREPSDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003656  Znf_BED  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF02892  zf-BED  
PROSITE View protein in PROSITE  
PS50808  ZF_BED  
Amino Acid Sequences MARETRSKRKRPNPIIQREPSDSSDSDSSTKEAANSSIKVTATASKIPKTKAQVSVAATPTSTPAQETPTLIDPEPDQTDSTSTNPTKVKSCSDVWEHFKKVGVGEAAKAHCNYCRSELNGNSGNGTLALRRHLERCKNYAKCTKQTMLKLSGGNSAPSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.87
4 0.84
5 0.78
6 0.72
7 0.64
8 0.58
9 0.47
10 0.41
11 0.37
12 0.31
13 0.28
14 0.24
15 0.22
16 0.19
17 0.19
18 0.15
19 0.14
20 0.16
21 0.18
22 0.18
23 0.18
24 0.2
25 0.2
26 0.19
27 0.2
28 0.21
29 0.19
30 0.24
31 0.25
32 0.27
33 0.31
34 0.32
35 0.36
36 0.38
37 0.41
38 0.42
39 0.42
40 0.42
41 0.41
42 0.45
43 0.42
44 0.36
45 0.3
46 0.23
47 0.22
48 0.18
49 0.14
50 0.09
51 0.08
52 0.11
53 0.12
54 0.12
55 0.13
56 0.15
57 0.17
58 0.16
59 0.15
60 0.13
61 0.14
62 0.15
63 0.14
64 0.11
65 0.1
66 0.11
67 0.12
68 0.13
69 0.16
70 0.14
71 0.18
72 0.19
73 0.2
74 0.22
75 0.23
76 0.25
77 0.23
78 0.25
79 0.25
80 0.29
81 0.33
82 0.36
83 0.4
84 0.39
85 0.35
86 0.35
87 0.32
88 0.27
89 0.24
90 0.2
91 0.14
92 0.15
93 0.18
94 0.18
95 0.19
96 0.19
97 0.17
98 0.18
99 0.19
100 0.2
101 0.2
102 0.23
103 0.25
104 0.31
105 0.33
106 0.37
107 0.4
108 0.38
109 0.34
110 0.3
111 0.27
112 0.21
113 0.19
114 0.14
115 0.1
116 0.12
117 0.14
118 0.16
119 0.22
120 0.3
121 0.39
122 0.43
123 0.5
124 0.58
125 0.61
126 0.67
127 0.72
128 0.72
129 0.7
130 0.72
131 0.71
132 0.69
133 0.7
134 0.69
135 0.65
136 0.61
137 0.56
138 0.5
139 0.5
140 0.43