Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0RQT2

Protein Details
Accession A0A5B0RQT2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-76PKDARDCPKKKLRRCCNMLASKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, E.R. 8, golg 3, plas 2, pero 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MKLIIIGIMLVTFASSDVIKPPVYPLKWGCDKFQVNDVDFSFPGCEVEFEVNDVPKDARDCPKKKLRRCCNMLASKAVSYGGDCVNAPKRGHIHSPDQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.08
5 0.1
6 0.11
7 0.11
8 0.15
9 0.22
10 0.23
11 0.27
12 0.27
13 0.33
14 0.41
15 0.42
16 0.4
17 0.41
18 0.43
19 0.39
20 0.44
21 0.4
22 0.33
23 0.35
24 0.33
25 0.27
26 0.24
27 0.23
28 0.16
29 0.12
30 0.11
31 0.08
32 0.07
33 0.06
34 0.07
35 0.07
36 0.08
37 0.08
38 0.08
39 0.08
40 0.09
41 0.08
42 0.08
43 0.09
44 0.11
45 0.19
46 0.28
47 0.32
48 0.39
49 0.5
50 0.58
51 0.65
52 0.73
53 0.76
54 0.77
55 0.8
56 0.81
57 0.81
58 0.79
59 0.73
60 0.67
61 0.6
62 0.49
63 0.43
64 0.35
65 0.25
66 0.18
67 0.17
68 0.13
69 0.11
70 0.11
71 0.15
72 0.21
73 0.27
74 0.27
75 0.3
76 0.33
77 0.37
78 0.45
79 0.45