Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0MMY2

Protein Details
Accession A0A5B0MMY2   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
134-153FEEYHKHRHRSEPHHEERIRBasic
NLS Segment(s)
Subcellular Location(s) cysk 4, cyto 9, mito_nucl 4, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR016477  Fructo-/Ketosamine-3-kinase  
IPR011009  Kinase-like_dom_sf  
Gene Ontology GO:0102193  F:protein-ribulosamine 3-kinase activity  
Pfam View protein in Pfam  
PF03881  Fructosamin_kin  
Amino Acid Sequences MHDPTNPASQAPNGMYGFDVPTHCGETEQDNTWEKDWMVFFRDRRIKSLVDRIGDEDIKQLGKTLCDEVIPFLLTDFHPAPVPVIIHGDLWSGNISVNRQTGEPVLFDPSSYYGHSEVELGIMKMFGGRTNAFFEEYHKHRHRSEPHHEERIRYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.2
5 0.17
6 0.17
7 0.13
8 0.14
9 0.16
10 0.16
11 0.16
12 0.16
13 0.18
14 0.21
15 0.22
16 0.25
17 0.25
18 0.27
19 0.27
20 0.27
21 0.23
22 0.22
23 0.21
24 0.18
25 0.2
26 0.23
27 0.23
28 0.31
29 0.4
30 0.37
31 0.4
32 0.41
33 0.4
34 0.39
35 0.48
36 0.43
37 0.37
38 0.36
39 0.35
40 0.35
41 0.32
42 0.27
43 0.19
44 0.16
45 0.14
46 0.13
47 0.14
48 0.1
49 0.11
50 0.12
51 0.12
52 0.11
53 0.11
54 0.11
55 0.09
56 0.09
57 0.09
58 0.07
59 0.06
60 0.07
61 0.06
62 0.1
63 0.09
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.06
71 0.07
72 0.07
73 0.07
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.06
80 0.06
81 0.07
82 0.08
83 0.1
84 0.11
85 0.11
86 0.11
87 0.11
88 0.12
89 0.12
90 0.12
91 0.1
92 0.13
93 0.12
94 0.12
95 0.12
96 0.13
97 0.14
98 0.13
99 0.14
100 0.12
101 0.12
102 0.12
103 0.12
104 0.1
105 0.1
106 0.1
107 0.09
108 0.08
109 0.07
110 0.07
111 0.08
112 0.08
113 0.08
114 0.11
115 0.11
116 0.13
117 0.18
118 0.19
119 0.2
120 0.2
121 0.23
122 0.27
123 0.3
124 0.38
125 0.4
126 0.44
127 0.46
128 0.56
129 0.62
130 0.63
131 0.71
132 0.72
133 0.74
134 0.8
135 0.79