Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0PX40

Protein Details
Accession A0A5B0PX40    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
47-67GDSRRDESQRKDRQQFHLRALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 6.5cyto_nucl 6.5, mito 6, cyto 5.5, pero 5, extr 3
Family & Domain DBs
Amino Acid Sequences MSLGTLFLAGDTVFYIPAGTCRELRWNNWVETCALAVVTVESAVDDGDSRRDESQRKDRQQFHLRAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.05
4 0.08
5 0.11
6 0.12
7 0.13
8 0.14
9 0.23
10 0.25
11 0.27
12 0.32
13 0.32
14 0.32
15 0.33
16 0.32
17 0.24
18 0.22
19 0.2
20 0.13
21 0.08
22 0.06
23 0.05
24 0.04
25 0.03
26 0.03
27 0.03
28 0.02
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.07
35 0.09
36 0.11
37 0.13
38 0.18
39 0.23
40 0.32
41 0.42
42 0.5
43 0.58
44 0.66
45 0.71
46 0.77
47 0.83