Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0S112

Protein Details
Accession A0A5B0S112   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-41RSDMYRRRENLRKRQKRAETLIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9cyto_mito 9mito 9
Family & Domain DBs
Amino Acid Sequences MGEGFLSVQSGPGGWCTACRSDMYRRRENLRKRQKRAETLIYLQPRPNQVPAGFPYKVAAFHPALPPRIKLYILPLTSSIVAATVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.12
4 0.14
5 0.15
6 0.17
7 0.2
8 0.29
9 0.37
10 0.44
11 0.49
12 0.51
13 0.58
14 0.66
15 0.71
16 0.72
17 0.75
18 0.78
19 0.78
20 0.84
21 0.83
22 0.82
23 0.79
24 0.75
25 0.68
26 0.61
27 0.6
28 0.54
29 0.47
30 0.4
31 0.36
32 0.31
33 0.28
34 0.26
35 0.22
36 0.18
37 0.21
38 0.22
39 0.26
40 0.23
41 0.21
42 0.21
43 0.19
44 0.19
45 0.17
46 0.18
47 0.14
48 0.16
49 0.23
50 0.26
51 0.29
52 0.3
53 0.31
54 0.3
55 0.31
56 0.29
57 0.23
58 0.26
59 0.31
60 0.3
61 0.3
62 0.27
63 0.28
64 0.27
65 0.26
66 0.19