Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0NGD5

Protein Details
Accession A0A5B0NGD5   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
45-74EGEGGKQGSKSRRRRRPRRGGRRRSCESDHBasic
NLS Segment(s)
PositionSequence
50-68KQGSKSRRRRRPRRGGRRR
Subcellular Location(s) cyto 3.5, cyto_nucl 13, nucl 21.5
Family & Domain DBs
Amino Acid Sequences MAAPGMVNGQGYLDLTDWIKDVEEAKGDLQSEEADLRPSVDQEVEGEGGKQGSKSRRRRRPRRGGRRRSCESDHPTCPSACPSPTSSKTLPTPSRIPLSSPIPVVPLLSQILPSLAFQHPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.09
5 0.09
6 0.09
7 0.09
8 0.1
9 0.1
10 0.11
11 0.12
12 0.12
13 0.14
14 0.14
15 0.13
16 0.12
17 0.11
18 0.1
19 0.1
20 0.1
21 0.09
22 0.09
23 0.1
24 0.1
25 0.1
26 0.1
27 0.09
28 0.09
29 0.08
30 0.09
31 0.09
32 0.08
33 0.08
34 0.07
35 0.08
36 0.08
37 0.07
38 0.1
39 0.17
40 0.27
41 0.38
42 0.48
43 0.59
44 0.7
45 0.8
46 0.87
47 0.91
48 0.93
49 0.94
50 0.94
51 0.95
52 0.95
53 0.93
54 0.88
55 0.83
56 0.76
57 0.74
58 0.7
59 0.65
60 0.58
61 0.53
62 0.49
63 0.42
64 0.38
65 0.33
66 0.28
67 0.22
68 0.21
69 0.21
70 0.28
71 0.31
72 0.36
73 0.33
74 0.35
75 0.38
76 0.45
77 0.44
78 0.41
79 0.42
80 0.4
81 0.45
82 0.41
83 0.4
84 0.36
85 0.37
86 0.35
87 0.32
88 0.28
89 0.24
90 0.24
91 0.22
92 0.17
93 0.15
94 0.14
95 0.12
96 0.12
97 0.11
98 0.12
99 0.11
100 0.11
101 0.13