Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0N5A6

Protein Details
Accession A0A5B0N5A6    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-37SSFGKRHSKTHTQCRRCGRRSFHKQHKTCAACHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 7.5, cyto_nucl 7, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTSSFGKRHSKTHTQCRRCGRRSFHKQHKTCAACGFPAAKTRSYEWGAKVGSFSSYHPPIPATDLDYIPCPQAKRRHTTGTGRMRHLKDVPRRFKNGFREGTVATRKTASTPKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.76
4 0.73
5 0.79
6 0.83
7 0.85
8 0.82
9 0.82
10 0.8
11 0.8
12 0.84
13 0.86
14 0.87
15 0.86
16 0.83
17 0.82
18 0.83
19 0.75
20 0.67
21 0.61
22 0.51
23 0.41
24 0.39
25 0.33
26 0.24
27 0.27
28 0.26
29 0.23
30 0.23
31 0.25
32 0.28
33 0.29
34 0.3
35 0.25
36 0.28
37 0.26
38 0.24
39 0.22
40 0.17
41 0.15
42 0.13
43 0.14
44 0.13
45 0.15
46 0.15
47 0.15
48 0.15
49 0.14
50 0.16
51 0.15
52 0.12
53 0.13
54 0.13
55 0.13
56 0.14
57 0.15
58 0.13
59 0.15
60 0.13
61 0.17
62 0.26
63 0.3
64 0.35
65 0.41
66 0.47
67 0.51
68 0.58
69 0.62
70 0.64
71 0.65
72 0.64
73 0.67
74 0.61
75 0.6
76 0.58
77 0.57
78 0.57
79 0.62
80 0.67
81 0.66
82 0.71
83 0.7
84 0.72
85 0.73
86 0.72
87 0.66
88 0.6
89 0.56
90 0.52
91 0.56
92 0.55
93 0.47
94 0.39
95 0.36
96 0.33
97 0.33