Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0N3I4

Protein Details
Accession A0A5B0N3I4    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-123AQKTPVAKEKSNKNNKNKCDLKQKNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MDSLNRDLRPRFSELCRFLGSNGLANRLDKAIQGHLDSPKPLAFAESPPNPTTQPTPQIHCPHRTNFNFDMPSSNNKVKIIDPALATMVEVVDVKSSAQKTPVAKEKSNKNNKNKCDLKQKNIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.48
4 0.45
5 0.39
6 0.41
7 0.35
8 0.31
9 0.28
10 0.27
11 0.25
12 0.25
13 0.26
14 0.2
15 0.2
16 0.15
17 0.16
18 0.15
19 0.16
20 0.17
21 0.19
22 0.22
23 0.23
24 0.22
25 0.21
26 0.19
27 0.17
28 0.16
29 0.14
30 0.12
31 0.13
32 0.19
33 0.21
34 0.24
35 0.24
36 0.25
37 0.23
38 0.23
39 0.24
40 0.21
41 0.26
42 0.25
43 0.28
44 0.34
45 0.41
46 0.43
47 0.46
48 0.46
49 0.41
50 0.49
51 0.46
52 0.46
53 0.41
54 0.43
55 0.38
56 0.35
57 0.35
58 0.28
59 0.31
60 0.3
61 0.29
62 0.26
63 0.25
64 0.26
65 0.23
66 0.26
67 0.24
68 0.21
69 0.19
70 0.18
71 0.19
72 0.17
73 0.16
74 0.11
75 0.08
76 0.06
77 0.06
78 0.05
79 0.04
80 0.05
81 0.05
82 0.09
83 0.11
84 0.11
85 0.14
86 0.18
87 0.2
88 0.28
89 0.37
90 0.4
91 0.44
92 0.5
93 0.59
94 0.65
95 0.74
96 0.76
97 0.78
98 0.81
99 0.82
100 0.86
101 0.84
102 0.81
103 0.81
104 0.81