Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VXK9

Protein Details
Accession H1VXK9   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-42LYETRPNRWRGQKSTWQTYTHydrophilic
179-205ATILRQAKERFRRRQRKYYEKNATRARHydrophilic
328-374VSRASSATRRKRKGAPRSRAPRTPEPERKTTERRGRPRKAQLPLPGEHydrophilic
376-395EKEMKIRIAREQKKRIPFSSHydrophilic
NLS Segment(s)
PositionSequence
336-390TRRKRKGAPRSRAPRTPEPERKTTERRGRPRKAQLPLPGETEKEMKIRIAREQKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019622  Rrn9_dom  
Pfam View protein in Pfam  
PF10680  RRN9  
Amino Acid Sequences MTANEESWDLDTDEIRSVDSEELYETRPNRWRGQKSTWQTYTQEERLLHRSMEQLRNRDLSVHLYNAFALKHRPVRPSATAEPADAEVSSSGSTAIQQDTTRLSRVTDTAIQDVEKPLQEVVDSGEWRPPNLWTAWPMNHRNVPGDDFLKETHDEDDVFTFRSKKELLPSTPLEEELTATILRQAKERFRRRQRKYYEKNATRARDESAYETTGASSAAAHSAISSDDNDDDIPSNEEDAKEQPDERAGKAEKPKRSKTYEAAVSANDDLSANLLRPSVRHILSTLDNTLTALHNSRVAGLSYMTDSSAXATDGEASEASDAGSVSSAVSRASSATRRKRKGAPRSRAPRTPEPERKTTERRGRPRKAQLPLPGETEKEMKIRIAREQKKRIPFSSDEEDNADQVEEEGKMKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.15
5 0.16
6 0.15
7 0.14
8 0.13
9 0.15
10 0.17
11 0.22
12 0.22
13 0.27
14 0.35
15 0.4
16 0.46
17 0.55
18 0.61
19 0.64
20 0.72
21 0.75
22 0.77
23 0.82
24 0.78
25 0.72
26 0.66
27 0.65
28 0.64
29 0.57
30 0.54
31 0.45
32 0.45
33 0.45
34 0.45
35 0.38
36 0.32
37 0.36
38 0.38
39 0.46
40 0.47
41 0.48
42 0.51
43 0.53
44 0.51
45 0.46
46 0.39
47 0.36
48 0.33
49 0.31
50 0.26
51 0.24
52 0.24
53 0.24
54 0.22
55 0.17
56 0.18
57 0.21
58 0.29
59 0.33
60 0.37
61 0.39
62 0.45
63 0.49
64 0.53
65 0.5
66 0.49
67 0.45
68 0.42
69 0.39
70 0.33
71 0.29
72 0.2
73 0.17
74 0.09
75 0.09
76 0.09
77 0.07
78 0.07
79 0.06
80 0.07
81 0.08
82 0.09
83 0.1
84 0.1
85 0.12
86 0.16
87 0.18
88 0.19
89 0.18
90 0.18
91 0.17
92 0.18
93 0.21
94 0.22
95 0.22
96 0.22
97 0.23
98 0.22
99 0.21
100 0.22
101 0.2
102 0.16
103 0.14
104 0.12
105 0.11
106 0.11
107 0.1
108 0.11
109 0.13
110 0.14
111 0.13
112 0.18
113 0.18
114 0.18
115 0.19
116 0.17
117 0.15
118 0.16
119 0.17
120 0.16
121 0.21
122 0.25
123 0.32
124 0.35
125 0.37
126 0.39
127 0.38
128 0.37
129 0.34
130 0.32
131 0.28
132 0.25
133 0.21
134 0.19
135 0.19
136 0.18
137 0.17
138 0.16
139 0.13
140 0.13
141 0.12
142 0.12
143 0.13
144 0.12
145 0.12
146 0.12
147 0.13
148 0.12
149 0.15
150 0.15
151 0.15
152 0.21
153 0.27
154 0.28
155 0.32
156 0.34
157 0.34
158 0.33
159 0.32
160 0.25
161 0.19
162 0.17
163 0.11
164 0.1
165 0.07
166 0.06
167 0.1
168 0.12
169 0.13
170 0.16
171 0.19
172 0.26
173 0.36
174 0.46
175 0.53
176 0.61
177 0.71
178 0.76
179 0.83
180 0.85
181 0.86
182 0.85
183 0.86
184 0.86
185 0.81
186 0.81
187 0.79
188 0.72
189 0.64
190 0.56
191 0.47
192 0.38
193 0.33
194 0.28
195 0.22
196 0.19
197 0.17
198 0.15
199 0.13
200 0.11
201 0.1
202 0.07
203 0.05
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.05
212 0.05
213 0.06
214 0.06
215 0.06
216 0.06
217 0.07
218 0.07
219 0.07
220 0.09
221 0.08
222 0.09
223 0.09
224 0.09
225 0.1
226 0.11
227 0.12
228 0.12
229 0.12
230 0.12
231 0.16
232 0.18
233 0.17
234 0.22
235 0.21
236 0.26
237 0.35
238 0.42
239 0.44
240 0.51
241 0.59
242 0.59
243 0.64
244 0.64
245 0.6
246 0.61
247 0.59
248 0.53
249 0.47
250 0.4
251 0.35
252 0.3
253 0.25
254 0.17
255 0.11
256 0.08
257 0.08
258 0.08
259 0.06
260 0.07
261 0.07
262 0.07
263 0.07
264 0.13
265 0.17
266 0.17
267 0.18
268 0.18
269 0.2
270 0.23
271 0.25
272 0.22
273 0.16
274 0.16
275 0.15
276 0.16
277 0.13
278 0.12
279 0.11
280 0.1
281 0.12
282 0.12
283 0.13
284 0.13
285 0.13
286 0.12
287 0.11
288 0.11
289 0.1
290 0.1
291 0.09
292 0.08
293 0.08
294 0.08
295 0.09
296 0.08
297 0.07
298 0.07
299 0.07
300 0.07
301 0.07
302 0.06
303 0.05
304 0.05
305 0.05
306 0.06
307 0.05
308 0.05
309 0.05
310 0.05
311 0.05
312 0.06
313 0.06
314 0.05
315 0.06
316 0.06
317 0.07
318 0.11
319 0.19
320 0.28
321 0.39
322 0.49
323 0.55
324 0.61
325 0.7
326 0.76
327 0.8
328 0.81
329 0.81
330 0.82
331 0.86
332 0.88
333 0.86
334 0.84
335 0.83
336 0.8
337 0.8
338 0.8
339 0.76
340 0.75
341 0.75
342 0.75
343 0.73
344 0.76
345 0.76
346 0.76
347 0.8
348 0.83
349 0.87
350 0.89
351 0.91
352 0.9
353 0.87
354 0.84
355 0.83
356 0.78
357 0.71
358 0.66
359 0.57
360 0.5
361 0.44
362 0.39
363 0.32
364 0.29
365 0.27
366 0.25
367 0.28
368 0.3
369 0.37
370 0.45
371 0.52
372 0.6
373 0.69
374 0.74
375 0.8
376 0.84
377 0.78
378 0.75
379 0.7
380 0.67
381 0.65
382 0.6
383 0.52
384 0.5
385 0.47
386 0.4
387 0.36
388 0.28
389 0.19
390 0.16
391 0.15
392 0.11