Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VCD9

Protein Details
Accession H1VCD9    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
144-171VAWYIRDRIQRRRRRQKRQFRTGLRAQSHydrophilic
NLS Segment(s)
PositionSequence
153-170QRRRRRQKRQFRTGLRAQ
Subcellular Location(s) nucl 17, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
KEGG chig:CH63R_00660  -  
Amino Acid Sequences MASNLPTFNFNPLAPVTPPPEHLTFRKPALPLSAQLKRKAAEANITDDHVTATKMNKEESSQNTPFMASMAAPPKPTSIPNASAADPNQPTMDPRYMAMVSRIAAYYQQRCQAISNAQQQKCQAWANMHRQKCQEMMQAAMLVVAWYIRDRIQRRRRRQKRQFRTGLRAQSTRSRIAKGEGVRRWVMNVPEGLSSPQVPGVDGLADQEEAHFSMDREVPPDKDAKLFEMADGMIRSQYRKIEVPILGVLGFDEDESESESEADDDFDQLMEDEFEDGAVEEYDEDEDDLDLDDEYEDEEQEAGSEVVHRGTGTGTGSRGKDSGLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.28
4 0.27
5 0.31
6 0.32
7 0.35
8 0.36
9 0.39
10 0.41
11 0.4
12 0.42
13 0.45
14 0.41
15 0.38
16 0.41
17 0.39
18 0.38
19 0.41
20 0.46
21 0.45
22 0.49
23 0.51
24 0.45
25 0.45
26 0.44
27 0.38
28 0.38
29 0.36
30 0.38
31 0.35
32 0.36
33 0.33
34 0.29
35 0.27
36 0.19
37 0.18
38 0.13
39 0.15
40 0.19
41 0.2
42 0.22
43 0.22
44 0.25
45 0.31
46 0.35
47 0.41
48 0.37
49 0.38
50 0.36
51 0.35
52 0.32
53 0.25
54 0.19
55 0.1
56 0.13
57 0.16
58 0.17
59 0.18
60 0.18
61 0.2
62 0.21
63 0.22
64 0.22
65 0.23
66 0.25
67 0.29
68 0.31
69 0.3
70 0.31
71 0.31
72 0.32
73 0.27
74 0.24
75 0.2
76 0.18
77 0.19
78 0.21
79 0.22
80 0.16
81 0.16
82 0.19
83 0.18
84 0.19
85 0.19
86 0.16
87 0.13
88 0.14
89 0.14
90 0.1
91 0.13
92 0.17
93 0.19
94 0.21
95 0.25
96 0.25
97 0.25
98 0.27
99 0.27
100 0.28
101 0.32
102 0.38
103 0.43
104 0.44
105 0.45
106 0.45
107 0.42
108 0.4
109 0.34
110 0.26
111 0.23
112 0.3
113 0.39
114 0.45
115 0.47
116 0.48
117 0.48
118 0.47
119 0.44
120 0.4
121 0.34
122 0.27
123 0.25
124 0.22
125 0.2
126 0.18
127 0.15
128 0.12
129 0.06
130 0.05
131 0.04
132 0.03
133 0.03
134 0.04
135 0.06
136 0.13
137 0.17
138 0.28
139 0.39
140 0.49
141 0.6
142 0.71
143 0.79
144 0.85
145 0.92
146 0.93
147 0.93
148 0.94
149 0.93
150 0.88
151 0.85
152 0.81
153 0.78
154 0.7
155 0.61
156 0.52
157 0.5
158 0.46
159 0.45
160 0.39
161 0.33
162 0.29
163 0.3
164 0.33
165 0.3
166 0.35
167 0.31
168 0.33
169 0.33
170 0.32
171 0.31
172 0.29
173 0.25
174 0.19
175 0.17
176 0.14
177 0.14
178 0.15
179 0.13
180 0.11
181 0.11
182 0.09
183 0.1
184 0.09
185 0.08
186 0.08
187 0.07
188 0.07
189 0.06
190 0.07
191 0.05
192 0.06
193 0.05
194 0.05
195 0.05
196 0.05
197 0.07
198 0.07
199 0.06
200 0.09
201 0.12
202 0.12
203 0.14
204 0.16
205 0.16
206 0.17
207 0.2
208 0.18
209 0.19
210 0.19
211 0.19
212 0.21
213 0.2
214 0.18
215 0.17
216 0.16
217 0.14
218 0.14
219 0.12
220 0.1
221 0.1
222 0.12
223 0.13
224 0.15
225 0.17
226 0.19
227 0.21
228 0.26
229 0.26
230 0.27
231 0.25
232 0.23
233 0.2
234 0.17
235 0.15
236 0.09
237 0.08
238 0.05
239 0.05
240 0.05
241 0.05
242 0.08
243 0.08
244 0.08
245 0.08
246 0.08
247 0.08
248 0.08
249 0.09
250 0.07
251 0.07
252 0.07
253 0.07
254 0.07
255 0.07
256 0.07
257 0.06
258 0.06
259 0.06
260 0.06
261 0.06
262 0.06
263 0.06
264 0.06
265 0.06
266 0.06
267 0.05
268 0.06
269 0.06
270 0.06
271 0.06
272 0.06
273 0.06
274 0.06
275 0.07
276 0.07
277 0.06
278 0.06
279 0.06
280 0.06
281 0.07
282 0.07
283 0.06
284 0.06
285 0.07
286 0.06
287 0.06
288 0.08
289 0.07
290 0.06
291 0.08
292 0.09
293 0.09
294 0.1
295 0.1
296 0.08
297 0.09
298 0.11
299 0.12
300 0.14
301 0.15
302 0.21
303 0.22
304 0.24
305 0.23
306 0.22