Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VVH0

Protein Details
Accession H1VVH0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
390-412AMLVMWRRYLRRRWMQRIADANNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, extr 6, E.R. 2, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR017946  PLC-like_Pdiesterase_TIM-brl  
Gene Ontology GO:0016020  C:membrane  
GO:0008081  F:phosphoric diester hydrolase activity  
GO:0006629  P:lipid metabolic process  
Amino Acid Sequences MTLGITVGASTVLLILFALVFVSKPDSSIQSLPYEFISSNPLSSDGNSDEVMNRWLADYSRSVIPKPCHSHNDYWRPYPLFSALVAGCTGVEADIWLSDDGTDLLVGHDRGALSANKTLTTMYLDPLMKILDAENPESRWANHTPYDQPRGAFKTDPNATLVLLIDVKSDPRDTWPLLVKQLEPLRRKQFLTRYEHIQVGPGLETKQSRWPAAVTVVGTGNLDRPTFYDYENRSYPDFYAYHDTFIDAPLEVLPVENTFWRYEGNDPDYRGAITSSSRMWDVDETYMTSTSFKQAIGSVRTGFSGAQLARLRQQIKTARLSGLRTRYWDIPDWPIGYREYIWQVLVEEGVDLLNVDDLEGATRRGWVEGYIKDVIWMAVVSTYVFGCGFAMLVMWRRYLRRRWMQRIADANNAELVGHMGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.1
10 0.09
11 0.11
12 0.13
13 0.17
14 0.21
15 0.24
16 0.26
17 0.26
18 0.27
19 0.27
20 0.26
21 0.25
22 0.21
23 0.19
24 0.22
25 0.18
26 0.18
27 0.17
28 0.18
29 0.16
30 0.17
31 0.2
32 0.16
33 0.18
34 0.17
35 0.18
36 0.17
37 0.18
38 0.19
39 0.15
40 0.13
41 0.12
42 0.13
43 0.13
44 0.14
45 0.15
46 0.17
47 0.22
48 0.24
49 0.25
50 0.31
51 0.35
52 0.42
53 0.46
54 0.49
55 0.51
56 0.56
57 0.64
58 0.67
59 0.73
60 0.69
61 0.67
62 0.67
63 0.62
64 0.56
65 0.49
66 0.4
67 0.31
68 0.25
69 0.25
70 0.19
71 0.17
72 0.16
73 0.14
74 0.11
75 0.09
76 0.09
77 0.04
78 0.04
79 0.03
80 0.04
81 0.04
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.04
91 0.05
92 0.07
93 0.08
94 0.07
95 0.08
96 0.08
97 0.08
98 0.11
99 0.12
100 0.12
101 0.15
102 0.16
103 0.15
104 0.15
105 0.15
106 0.13
107 0.16
108 0.15
109 0.12
110 0.17
111 0.17
112 0.17
113 0.17
114 0.17
115 0.12
116 0.12
117 0.12
118 0.1
119 0.11
120 0.14
121 0.15
122 0.16
123 0.18
124 0.19
125 0.19
126 0.19
127 0.2
128 0.21
129 0.22
130 0.25
131 0.3
132 0.36
133 0.42
134 0.39
135 0.37
136 0.38
137 0.38
138 0.37
139 0.32
140 0.26
141 0.29
142 0.3
143 0.3
144 0.27
145 0.24
146 0.21
147 0.2
148 0.19
149 0.11
150 0.09
151 0.08
152 0.07
153 0.07
154 0.07
155 0.08
156 0.08
157 0.08
158 0.1
159 0.14
160 0.14
161 0.17
162 0.22
163 0.23
164 0.25
165 0.26
166 0.23
167 0.25
168 0.3
169 0.34
170 0.32
171 0.37
172 0.41
173 0.43
174 0.44
175 0.45
176 0.47
177 0.48
178 0.54
179 0.49
180 0.49
181 0.47
182 0.48
183 0.42
184 0.35
185 0.27
186 0.2
187 0.17
188 0.12
189 0.1
190 0.1
191 0.1
192 0.1
193 0.17
194 0.18
195 0.17
196 0.17
197 0.17
198 0.17
199 0.17
200 0.17
201 0.11
202 0.1
203 0.1
204 0.09
205 0.09
206 0.08
207 0.09
208 0.08
209 0.08
210 0.07
211 0.08
212 0.1
213 0.11
214 0.12
215 0.17
216 0.19
217 0.24
218 0.25
219 0.26
220 0.25
221 0.25
222 0.24
223 0.21
224 0.18
225 0.15
226 0.21
227 0.2
228 0.21
229 0.2
230 0.2
231 0.16
232 0.16
233 0.15
234 0.07
235 0.07
236 0.06
237 0.06
238 0.05
239 0.05
240 0.05
241 0.05
242 0.05
243 0.06
244 0.08
245 0.08
246 0.08
247 0.09
248 0.1
249 0.13
250 0.18
251 0.23
252 0.24
253 0.25
254 0.26
255 0.26
256 0.24
257 0.21
258 0.16
259 0.12
260 0.1
261 0.1
262 0.1
263 0.1
264 0.11
265 0.1
266 0.11
267 0.11
268 0.12
269 0.12
270 0.12
271 0.12
272 0.13
273 0.13
274 0.13
275 0.12
276 0.11
277 0.12
278 0.13
279 0.11
280 0.11
281 0.14
282 0.18
283 0.2
284 0.22
285 0.21
286 0.2
287 0.2
288 0.2
289 0.17
290 0.13
291 0.15
292 0.13
293 0.18
294 0.2
295 0.21
296 0.24
297 0.3
298 0.31
299 0.26
300 0.35
301 0.35
302 0.39
303 0.44
304 0.42
305 0.41
306 0.43
307 0.46
308 0.46
309 0.45
310 0.42
311 0.4
312 0.41
313 0.41
314 0.41
315 0.41
316 0.37
317 0.36
318 0.37
319 0.35
320 0.32
321 0.3
322 0.27
323 0.25
324 0.22
325 0.21
326 0.2
327 0.19
328 0.18
329 0.17
330 0.17
331 0.15
332 0.15
333 0.11
334 0.07
335 0.06
336 0.06
337 0.05
338 0.04
339 0.04
340 0.05
341 0.04
342 0.04
343 0.05
344 0.05
345 0.07
346 0.07
347 0.09
348 0.08
349 0.1
350 0.11
351 0.11
352 0.12
353 0.13
354 0.18
355 0.18
356 0.23
357 0.23
358 0.22
359 0.22
360 0.22
361 0.19
362 0.14
363 0.13
364 0.08
365 0.07
366 0.07
367 0.07
368 0.07
369 0.07
370 0.07
371 0.07
372 0.07
373 0.06
374 0.06
375 0.06
376 0.05
377 0.06
378 0.07
379 0.13
380 0.14
381 0.17
382 0.2
383 0.26
384 0.34
385 0.42
386 0.51
387 0.56
388 0.66
389 0.73
390 0.81
391 0.83
392 0.84
393 0.85
394 0.79
395 0.77
396 0.67
397 0.58
398 0.49
399 0.41
400 0.32
401 0.22
402 0.19