Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VLT5

Protein Details
Accession H1VLT5   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-97GVDYKRRHCRWPTRNVFKGPGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5, cyto_mito 9.833, cyto 8, cyto_nucl 7.333, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011118  Tannase/feruloyl_esterase  
Gene Ontology GO:0052689  F:carboxylic ester hydrolase activity  
Pfam View protein in Pfam  
PF07519  Tannase  
Amino Acid Sequences MGRKPAELDEFYRFFRISGLAHCSGGTGAVYIGNQARNAAGLEPEENVLMAMVRWVEEGVAPEXVTGTAFVNNTVSAGVDYKRRHCRWPTRNVFKGPGDFRDENNWECVSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.22
4 0.17
5 0.18
6 0.23
7 0.22
8 0.22
9 0.22
10 0.21
11 0.19
12 0.17
13 0.13
14 0.07
15 0.05
16 0.05
17 0.05
18 0.06
19 0.08
20 0.09
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.07
28 0.07
29 0.07
30 0.07
31 0.08
32 0.07
33 0.06
34 0.06
35 0.05
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.05
46 0.06
47 0.06
48 0.06
49 0.05
50 0.06
51 0.05
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.08
65 0.14
66 0.17
67 0.25
68 0.35
69 0.38
70 0.45
71 0.53
72 0.63
73 0.66
74 0.74
75 0.77
76 0.78
77 0.83
78 0.81
79 0.78
80 0.71
81 0.71
82 0.63
83 0.57
84 0.55
85 0.49
86 0.46
87 0.49
88 0.48
89 0.42
90 0.42