Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V1L1

Protein Details
Accession H1V1L1   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-49TSPQQNKMVKKEKKSEKKVKAAAAHydrophilic
NLS Segment(s)
PositionSequence
35-45KKEKKSEKKVK
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSASAPPSWLFSNNFTKTNIDNITPTSPQQNKMVKKEKKSEKKVKAAAAPTQQAPPDQLMDLVDSFLSENAFTSAHEAFRKQRAQSGWXPSKKQATRPSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.37
4 0.35
5 0.39
6 0.35
7 0.27
8 0.24
9 0.26
10 0.28
11 0.26
12 0.26
13 0.27
14 0.28
15 0.29
16 0.35
17 0.4
18 0.42
19 0.51
20 0.6
21 0.58
22 0.63
23 0.7
24 0.73
25 0.76
26 0.8
27 0.82
28 0.8
29 0.83
30 0.81
31 0.76
32 0.7
33 0.63
34 0.57
35 0.51
36 0.43
37 0.35
38 0.31
39 0.27
40 0.21
41 0.19
42 0.15
43 0.12
44 0.1
45 0.09
46 0.08
47 0.09
48 0.08
49 0.08
50 0.06
51 0.05
52 0.06
53 0.06
54 0.06
55 0.04
56 0.05
57 0.06
58 0.06
59 0.06
60 0.09
61 0.09
62 0.12
63 0.13
64 0.16
65 0.19
66 0.27
67 0.33
68 0.31
69 0.36
70 0.38
71 0.42
72 0.5
73 0.57
74 0.59
75 0.61
76 0.67
77 0.68
78 0.71
79 0.74