Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V3L8

Protein Details
Accession H1V3L8   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
216-263DDAAKPPKPKKIKATKELEKGKSKWQEFNSKSKFGKHKKDSMFRTPDGHydrophilic
NLS Segment(s)
PositionSequence
220-254KPPKPKKIKATKELEKGKSKWQEFNSKSKFGKHKK
Subcellular Location(s) nucl 15, cyto_nucl 12.333, cyto 8.5, mito_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR041297  Crb2_Tudor  
IPR002999  Tudor  
IPR043560  ZGPAT  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0045892  P:negative regulation of DNA-templated transcription  
KEGG chig:CH63R_06419  -  
Pfam View protein in Pfam  
PF18115  Tudor_3  
CDD cd20446  Tudor_SpSPF30-like  
Amino Acid Sequences MSTQIAALEEDRQQYQEQLDVVLAGLKDDPENPELKNLQAELNDMISLLNESLAELQPKQAPKPATQKAPSPPEPEKWSKENHPAFKKAAPAPAPEEKDDAPPVTYQVNDTVMAKWASGDRGFYPARITSITGSSTAPIYIVKFKSYENTETLRAKDIRPVSNKRKADGAPASGPGTGQQAAHTPPVPSNGVVTSAAASLYPEQQAKMEAEKNAVDDAAKPPKPKKIKATKELEKGKSKWQEFNSKSKFGKHKKDSMFRTPDGVGGRVGFTGSGQAMRKDPGRSRHVYQQNDELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.19
5 0.16
6 0.16
7 0.14
8 0.13
9 0.13
10 0.12
11 0.09
12 0.09
13 0.09
14 0.1
15 0.11
16 0.14
17 0.14
18 0.16
19 0.16
20 0.22
21 0.23
22 0.23
23 0.25
24 0.23
25 0.23
26 0.22
27 0.23
28 0.18
29 0.18
30 0.16
31 0.13
32 0.12
33 0.09
34 0.09
35 0.07
36 0.06
37 0.05
38 0.05
39 0.08
40 0.09
41 0.11
42 0.1
43 0.13
44 0.17
45 0.2
46 0.21
47 0.24
48 0.26
49 0.31
50 0.41
51 0.45
52 0.49
53 0.5
54 0.55
55 0.58
56 0.64
57 0.62
58 0.59
59 0.56
60 0.54
61 0.58
62 0.58
63 0.55
64 0.5
65 0.5
66 0.5
67 0.56
68 0.58
69 0.6
70 0.6
71 0.59
72 0.59
73 0.56
74 0.56
75 0.48
76 0.47
77 0.4
78 0.36
79 0.37
80 0.41
81 0.41
82 0.35
83 0.35
84 0.29
85 0.3
86 0.29
87 0.24
88 0.18
89 0.15
90 0.16
91 0.14
92 0.13
93 0.11
94 0.11
95 0.12
96 0.11
97 0.12
98 0.11
99 0.13
100 0.13
101 0.12
102 0.1
103 0.1
104 0.11
105 0.1
106 0.11
107 0.09
108 0.14
109 0.15
110 0.14
111 0.15
112 0.14
113 0.15
114 0.14
115 0.14
116 0.1
117 0.12
118 0.12
119 0.11
120 0.11
121 0.1
122 0.09
123 0.08
124 0.08
125 0.06
126 0.07
127 0.11
128 0.11
129 0.12
130 0.12
131 0.12
132 0.16
133 0.19
134 0.2
135 0.18
136 0.2
137 0.23
138 0.24
139 0.25
140 0.26
141 0.24
142 0.22
143 0.25
144 0.27
145 0.3
146 0.35
147 0.43
148 0.46
149 0.55
150 0.55
151 0.51
152 0.52
153 0.46
154 0.46
155 0.41
156 0.37
157 0.29
158 0.29
159 0.29
160 0.23
161 0.23
162 0.16
163 0.14
164 0.11
165 0.09
166 0.08
167 0.1
168 0.11
169 0.13
170 0.13
171 0.12
172 0.12
173 0.15
174 0.15
175 0.14
176 0.13
177 0.12
178 0.13
179 0.12
180 0.12
181 0.09
182 0.08
183 0.08
184 0.07
185 0.07
186 0.06
187 0.08
188 0.1
189 0.09
190 0.1
191 0.1
192 0.12
193 0.13
194 0.16
195 0.18
196 0.17
197 0.19
198 0.19
199 0.2
200 0.18
201 0.17
202 0.13
203 0.11
204 0.16
205 0.23
206 0.25
207 0.28
208 0.31
209 0.41
210 0.48
211 0.53
212 0.59
213 0.61
214 0.68
215 0.74
216 0.81
217 0.81
218 0.83
219 0.86
220 0.83
221 0.8
222 0.73
223 0.72
224 0.72
225 0.66
226 0.64
227 0.61
228 0.65
229 0.6
230 0.69
231 0.66
232 0.65
233 0.63
234 0.64
235 0.68
236 0.67
237 0.74
238 0.71
239 0.74
240 0.76
241 0.84
242 0.82
243 0.82
244 0.81
245 0.71
246 0.67
247 0.58
248 0.52
249 0.45
250 0.38
251 0.29
252 0.22
253 0.21
254 0.16
255 0.16
256 0.12
257 0.09
258 0.1
259 0.1
260 0.14
261 0.15
262 0.17
263 0.19
264 0.23
265 0.27
266 0.32
267 0.38
268 0.43
269 0.49
270 0.53
271 0.56
272 0.63
273 0.68
274 0.68
275 0.66