Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3DZX8

Protein Details
Accession A0A5C3DZX8   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
85-104KVSVKKNKDLPTRVKKNHSPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15, nucl 23.5
Family & Domain DBs
Amino Acid Sequences MSTKPRSDSATSTSSTSSTDPYANSSVFRNSPYYKSEQLDDLSHGTTAKARRWSGAKKNPGEGRSHFESRIISSDQTKLTRDEIKVSVKKNKDLPTRVKKNHSPAQAAKVYDAMNKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.22
4 0.19
5 0.16
6 0.16
7 0.15
8 0.18
9 0.21
10 0.19
11 0.19
12 0.19
13 0.21
14 0.2
15 0.22
16 0.23
17 0.23
18 0.25
19 0.28
20 0.32
21 0.32
22 0.33
23 0.32
24 0.3
25 0.29
26 0.27
27 0.25
28 0.21
29 0.17
30 0.16
31 0.14
32 0.12
33 0.13
34 0.15
35 0.17
36 0.21
37 0.21
38 0.23
39 0.29
40 0.37
41 0.43
42 0.5
43 0.54
44 0.5
45 0.56
46 0.58
47 0.54
48 0.5
49 0.42
50 0.39
51 0.37
52 0.37
53 0.31
54 0.28
55 0.27
56 0.24
57 0.25
58 0.21
59 0.16
60 0.16
61 0.19
62 0.21
63 0.22
64 0.22
65 0.2
66 0.22
67 0.27
68 0.26
69 0.27
70 0.28
71 0.35
72 0.39
73 0.42
74 0.48
75 0.46
76 0.51
77 0.54
78 0.58
79 0.59
80 0.62
81 0.68
82 0.7
83 0.77
84 0.79
85 0.81
86 0.8
87 0.8
88 0.8
89 0.76
90 0.73
91 0.68
92 0.69
93 0.65
94 0.58
95 0.5
96 0.45
97 0.39