Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3EP54

Protein Details
Accession A0A5C3EP54    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-31ASPSAPSRSYPNKRNRCDNGAIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016069  Translin_C  
IPR002848  Translin_fam  
IPR016068  Translin_N  
IPR036081  Translin_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF01997  Translin  
CDD cd14820  TRAX  
Amino Acid Sequences MVEEARQRKASPSAPSRSYPNKRNRCDNGAIPAEANQASASSSDSTKLLEAFRAFRDEIDSHNDRRERLIKSSRDVTSLSKKVIFLLHRFDIHDFASETPSNKTRKLFSEAETKLEEIVALLRQAAAAEGLGSIQTQQEQLDASTKRLTSQRYERNIGGGLEEFIEAISFYHYLRTTRLISLSQIQDRFRTDPVPESHFYSPLSSQAISASQPPASDSSTLVALHIPTHRYLLGLSDLTGELMRFATNAVGQGDTGAVIKQVLSLTRQLRDGLDPFVPLVRDLNKKQSVTNQSLRKIEDILYAITVRSAEYGSDPKALQEMVRRTLASSSSAQNSSDDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.62
4 0.66
5 0.69
6 0.69
7 0.71
8 0.73
9 0.76
10 0.83
11 0.83
12 0.8
13 0.78
14 0.73
15 0.71
16 0.65
17 0.58
18 0.48
19 0.42
20 0.38
21 0.31
22 0.26
23 0.17
24 0.12
25 0.12
26 0.11
27 0.12
28 0.1
29 0.1
30 0.11
31 0.12
32 0.12
33 0.13
34 0.15
35 0.14
36 0.16
37 0.18
38 0.2
39 0.22
40 0.25
41 0.24
42 0.23
43 0.27
44 0.24
45 0.24
46 0.29
47 0.31
48 0.29
49 0.36
50 0.38
51 0.33
52 0.39
53 0.43
54 0.39
55 0.44
56 0.51
57 0.48
58 0.52
59 0.59
60 0.54
61 0.49
62 0.47
63 0.44
64 0.45
65 0.43
66 0.4
67 0.35
68 0.34
69 0.33
70 0.36
71 0.34
72 0.28
73 0.31
74 0.31
75 0.3
76 0.32
77 0.31
78 0.28
79 0.24
80 0.23
81 0.18
82 0.15
83 0.18
84 0.18
85 0.18
86 0.2
87 0.25
88 0.26
89 0.28
90 0.3
91 0.29
92 0.32
93 0.38
94 0.37
95 0.35
96 0.42
97 0.4
98 0.41
99 0.38
100 0.34
101 0.27
102 0.23
103 0.2
104 0.1
105 0.1
106 0.07
107 0.06
108 0.06
109 0.05
110 0.05
111 0.05
112 0.05
113 0.04
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.04
122 0.04
123 0.05
124 0.05
125 0.05
126 0.06
127 0.06
128 0.12
129 0.12
130 0.14
131 0.16
132 0.16
133 0.18
134 0.21
135 0.23
136 0.23
137 0.32
138 0.39
139 0.42
140 0.46
141 0.44
142 0.42
143 0.41
144 0.35
145 0.26
146 0.18
147 0.12
148 0.09
149 0.09
150 0.07
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.06
159 0.07
160 0.08
161 0.09
162 0.12
163 0.13
164 0.14
165 0.16
166 0.14
167 0.15
168 0.19
169 0.21
170 0.21
171 0.23
172 0.22
173 0.23
174 0.25
175 0.25
176 0.21
177 0.2
178 0.17
179 0.21
180 0.23
181 0.26
182 0.25
183 0.28
184 0.27
185 0.27
186 0.27
187 0.22
188 0.2
189 0.16
190 0.17
191 0.13
192 0.12
193 0.11
194 0.12
195 0.11
196 0.12
197 0.11
198 0.1
199 0.1
200 0.1
201 0.11
202 0.12
203 0.12
204 0.1
205 0.1
206 0.11
207 0.11
208 0.1
209 0.09
210 0.08
211 0.1
212 0.11
213 0.12
214 0.11
215 0.12
216 0.12
217 0.12
218 0.11
219 0.11
220 0.12
221 0.11
222 0.1
223 0.1
224 0.1
225 0.1
226 0.1
227 0.08
228 0.06
229 0.06
230 0.06
231 0.05
232 0.05
233 0.06
234 0.06
235 0.08
236 0.08
237 0.08
238 0.08
239 0.08
240 0.08
241 0.07
242 0.07
243 0.05
244 0.05
245 0.05
246 0.05
247 0.06
248 0.07
249 0.08
250 0.09
251 0.15
252 0.19
253 0.21
254 0.22
255 0.22
256 0.23
257 0.25
258 0.26
259 0.22
260 0.2
261 0.19
262 0.18
263 0.19
264 0.17
265 0.14
266 0.15
267 0.18
268 0.25
269 0.28
270 0.37
271 0.41
272 0.42
273 0.44
274 0.5
275 0.53
276 0.54
277 0.59
278 0.57
279 0.57
280 0.6
281 0.59
282 0.52
283 0.45
284 0.39
285 0.35
286 0.29
287 0.24
288 0.22
289 0.2
290 0.18
291 0.17
292 0.15
293 0.11
294 0.1
295 0.09
296 0.08
297 0.11
298 0.16
299 0.17
300 0.21
301 0.21
302 0.2
303 0.22
304 0.22
305 0.21
306 0.25
307 0.29
308 0.3
309 0.34
310 0.33
311 0.32
312 0.35
313 0.34
314 0.29
315 0.26
316 0.27
317 0.29
318 0.3
319 0.3
320 0.28