Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3EJR0

Protein Details
Accession A0A5C3EJR0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-39YTTNGAPCKKTPKKALRRKGNRDHKKGPTGEBasic
NLS Segment(s)
PositionSequence
17-35KKTPKKALRRKGNRDHKKG
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MCVQRAKGYTTNGAPCKKTPKKALRRKGNRDHKKGPTGELSHTIDALLIAAYVRRGPCRPITTTLQTFRLGLDDGVDPSPSKFSAKGLRIWESILRSSQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.55
4 0.57
5 0.59
6 0.62
7 0.66
8 0.72
9 0.8
10 0.87
11 0.87
12 0.9
13 0.92
14 0.93
15 0.93
16 0.93
17 0.91
18 0.89
19 0.86
20 0.83
21 0.74
22 0.67
23 0.63
24 0.55
25 0.48
26 0.44
27 0.39
28 0.31
29 0.29
30 0.25
31 0.17
32 0.14
33 0.12
34 0.06
35 0.03
36 0.03
37 0.03
38 0.03
39 0.05
40 0.05
41 0.07
42 0.08
43 0.11
44 0.17
45 0.2
46 0.23
47 0.27
48 0.32
49 0.37
50 0.42
51 0.43
52 0.4
53 0.37
54 0.34
55 0.29
56 0.25
57 0.19
58 0.13
59 0.12
60 0.1
61 0.11
62 0.11
63 0.12
64 0.1
65 0.1
66 0.12
67 0.11
68 0.12
69 0.11
70 0.16
71 0.25
72 0.27
73 0.33
74 0.37
75 0.41
76 0.4
77 0.42
78 0.42
79 0.36
80 0.37