Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3EN61

Protein Details
Accession A0A5C3EN61   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
446-466TGSNTRQHRSHQQQQQRVLDAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 6, mito 5, nucl 11, plas 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR041848  Ste18_fungal  
Gene Ontology GO:0031681  F:G-protein beta-subunit binding  
GO:0007186  P:G protein-coupled receptor signaling pathway  
GO:0000750  P:pheromone-dependent signal transduction involved in conjugation with cellular fusion  
Amino Acid Sequences MTLSDSFWSFARLGQSWTHPAPPTKPRRRTAIYTQQHIETIGGSNDAPILPPPTPPQDPTIGDPRLPLELIVHVILLAAQDIFLQDAPTSTARLLDLARVNRVSHRAVLSTFLLPNLRLYGMQQIRAFAISLDKDRLGIRGLARSRVSTLTLRARSLGSLSHGYGPALFDASQAQVHFEKDLVPFIRLVLSHCASLQMLRIEGVPRGLSRALSTISPHLQEFTCLMGHYGADLDNDFWLPHRWSDLTELQLHGPRFRFTPDTARSLASLPGLKKLALVVPMIVASPSQSTNQDLDTVGSINPLQTLLELHPTLDLLLLIGHGERDYVGYTEKYRYWLRNLRKPRIGSSTMCRVELVTALRRSPSLGDEGQEDVVADSSRRRVHPCKVSAWMMDRSQQGLQWFDSEEEGGGDEAGLDFWVETFGLADSHPSSSSATVTTTSAIMSRTGSNTRQHRSHQQQQQRVLDAIEAADMLSSDDEGSAFDVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.34
4 0.36
5 0.39
6 0.38
7 0.42
8 0.46
9 0.53
10 0.59
11 0.63
12 0.7
13 0.71
14 0.76
15 0.78
16 0.78
17 0.79
18 0.78
19 0.76
20 0.74
21 0.72
22 0.65
23 0.58
24 0.5
25 0.4
26 0.3
27 0.24
28 0.17
29 0.14
30 0.12
31 0.11
32 0.12
33 0.11
34 0.11
35 0.1
36 0.12
37 0.12
38 0.14
39 0.18
40 0.24
41 0.27
42 0.29
43 0.31
44 0.34
45 0.36
46 0.38
47 0.43
48 0.38
49 0.35
50 0.35
51 0.32
52 0.28
53 0.26
54 0.21
55 0.14
56 0.13
57 0.15
58 0.13
59 0.12
60 0.09
61 0.09
62 0.09
63 0.07
64 0.06
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.05
73 0.06
74 0.09
75 0.1
76 0.11
77 0.1
78 0.11
79 0.11
80 0.12
81 0.12
82 0.15
83 0.2
84 0.22
85 0.26
86 0.26
87 0.27
88 0.29
89 0.32
90 0.29
91 0.27
92 0.27
93 0.25
94 0.23
95 0.26
96 0.24
97 0.23
98 0.21
99 0.18
100 0.18
101 0.16
102 0.17
103 0.15
104 0.13
105 0.11
106 0.12
107 0.2
108 0.21
109 0.25
110 0.25
111 0.24
112 0.24
113 0.24
114 0.24
115 0.14
116 0.16
117 0.13
118 0.15
119 0.16
120 0.15
121 0.16
122 0.16
123 0.17
124 0.15
125 0.16
126 0.16
127 0.21
128 0.23
129 0.26
130 0.27
131 0.27
132 0.27
133 0.25
134 0.27
135 0.21
136 0.25
137 0.29
138 0.3
139 0.3
140 0.29
141 0.28
142 0.25
143 0.24
144 0.2
145 0.14
146 0.14
147 0.15
148 0.16
149 0.16
150 0.15
151 0.15
152 0.14
153 0.11
154 0.1
155 0.09
156 0.07
157 0.07
158 0.08
159 0.09
160 0.09
161 0.11
162 0.1
163 0.11
164 0.11
165 0.1
166 0.12
167 0.11
168 0.16
169 0.14
170 0.14
171 0.13
172 0.13
173 0.15
174 0.12
175 0.14
176 0.15
177 0.15
178 0.14
179 0.14
180 0.15
181 0.13
182 0.13
183 0.14
184 0.09
185 0.08
186 0.08
187 0.09
188 0.09
189 0.1
190 0.1
191 0.08
192 0.08
193 0.1
194 0.1
195 0.09
196 0.09
197 0.1
198 0.1
199 0.1
200 0.11
201 0.12
202 0.13
203 0.14
204 0.13
205 0.13
206 0.12
207 0.12
208 0.12
209 0.1
210 0.09
211 0.08
212 0.09
213 0.07
214 0.07
215 0.06
216 0.06
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.07
226 0.08
227 0.08
228 0.09
229 0.09
230 0.1
231 0.15
232 0.17
233 0.17
234 0.17
235 0.18
236 0.17
237 0.21
238 0.2
239 0.18
240 0.17
241 0.16
242 0.15
243 0.17
244 0.18
245 0.16
246 0.25
247 0.25
248 0.28
249 0.29
250 0.28
251 0.27
252 0.26
253 0.25
254 0.17
255 0.17
256 0.14
257 0.16
258 0.16
259 0.15
260 0.14
261 0.14
262 0.14
263 0.12
264 0.11
265 0.08
266 0.08
267 0.08
268 0.08
269 0.07
270 0.05
271 0.04
272 0.05
273 0.06
274 0.07
275 0.08
276 0.1
277 0.11
278 0.12
279 0.12
280 0.11
281 0.11
282 0.1
283 0.1
284 0.08
285 0.08
286 0.08
287 0.07
288 0.07
289 0.06
290 0.05
291 0.05
292 0.06
293 0.06
294 0.1
295 0.1
296 0.1
297 0.1
298 0.1
299 0.1
300 0.09
301 0.08
302 0.04
303 0.04
304 0.04
305 0.04
306 0.04
307 0.04
308 0.03
309 0.04
310 0.04
311 0.04
312 0.05
313 0.06
314 0.07
315 0.09
316 0.11
317 0.14
318 0.15
319 0.19
320 0.23
321 0.25
322 0.32
323 0.39
324 0.46
325 0.53
326 0.62
327 0.66
328 0.7
329 0.69
330 0.66
331 0.65
332 0.61
333 0.55
334 0.51
335 0.53
336 0.47
337 0.44
338 0.39
339 0.32
340 0.28
341 0.27
342 0.25
343 0.21
344 0.22
345 0.22
346 0.23
347 0.22
348 0.23
349 0.21
350 0.19
351 0.17
352 0.16
353 0.16
354 0.17
355 0.19
356 0.18
357 0.16
358 0.15
359 0.1
360 0.1
361 0.09
362 0.08
363 0.08
364 0.13
365 0.18
366 0.2
367 0.27
368 0.33
369 0.42
370 0.51
371 0.54
372 0.54
373 0.56
374 0.57
375 0.54
376 0.53
377 0.49
378 0.41
379 0.41
380 0.37
381 0.34
382 0.31
383 0.29
384 0.26
385 0.24
386 0.23
387 0.19
388 0.19
389 0.17
390 0.17
391 0.15
392 0.13
393 0.1
394 0.1
395 0.08
396 0.07
397 0.06
398 0.05
399 0.05
400 0.05
401 0.04
402 0.04
403 0.03
404 0.04
405 0.04
406 0.04
407 0.04
408 0.05
409 0.05
410 0.06
411 0.06
412 0.08
413 0.09
414 0.11
415 0.11
416 0.12
417 0.13
418 0.13
419 0.15
420 0.13
421 0.13
422 0.13
423 0.13
424 0.13
425 0.12
426 0.12
427 0.12
428 0.12
429 0.11
430 0.12
431 0.14
432 0.17
433 0.22
434 0.26
435 0.33
436 0.41
437 0.48
438 0.52
439 0.56
440 0.63
441 0.68
442 0.74
443 0.76
444 0.78
445 0.79
446 0.82
447 0.83
448 0.76
449 0.67
450 0.58
451 0.48
452 0.38
453 0.29
454 0.2
455 0.13
456 0.09
457 0.07
458 0.07
459 0.06
460 0.06
461 0.06
462 0.06
463 0.06
464 0.06
465 0.06