FuNGI

A0A5C3EN61

Protein Details

Accession

A0A5C3EN61

Localization Confidence

Low

Confidence Score

8.9

NoLS Segment(s)

Position	Sequence	Protein Nature
446-466	TGSNTRQHRSHQQQQQRVLDA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 11, plas 6, cyto_nucl 6, mito 5

Family & Domain DBs

InterPro	View protein in InterPro IPR041848 Ste18_fungal
Gene Ontology	GO:0031681 F:G-protein beta-subunit binding GO:0007186 P:G protein-coupled receptor signaling pathway GO:0000750 P:pheromone-dependent signal transduction involved in conjugation with cellular fusion

Amino Acid Sequences

MTLSDSFWSFARLGQSWTHPAPPTKPRRRTAIYTQQHIETIGGSNDAPILPPPTPPQDPTIGDPRLPLELIVHVILLAAQDIFLQDAPTSTARLLDLARVNRVSHRAVLSTFLLPNLRLYGMQQIRAFAISLDKDRLGIRGLARSRVSTLTLRARSLGSLSHGYGPALFDASQAQVHFEKDLVPFIRLVLSHCASLQMLRIEGVPRGLSRALSTISPHLQEFTCLMGHYGADLDNDFWLPHRWSDLTELQLHGPRFRFTPDTARSLASLPGLKKLALVVPMIVASPSQSTNQDLDTVGSINPLQTLLELHPTLDLLLLIGHGERDYVGYTEKYRYWLRNLRKPRIGSSTMCRVELVTALRRSPSLGDEGQEDVVADSSRRRVHPCKVSAWMMDRSQQGLQWFDSEEEGGGDEAGLDFWVETFGLADSHPSSSSATVTTTSAIMSRTGSNTRQHRSHQQQQQRVLDAIEAADMLSSDDEGSAFDVA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.3
3	0.34
4	0.36
5	0.39
6	0.38
7	0.42
8	0.46
9	0.53
10	0.59
11	0.63
12	0.7
13	0.71
14	0.76
15	0.78
16	0.78
17	0.79
18	0.78
19	0.76
20	0.74
21	0.72
22	0.65
23	0.58
24	0.5
25	0.4
26	0.3
27	0.24
28	0.17
29	0.14
30	0.12
31	0.11
32	0.12
33	0.11
34	0.11
35	0.1
36	0.12
37	0.12
38	0.14
39	0.18
40	0.24
41	0.27
42	0.29
43	0.31
44	0.34
45	0.36
46	0.38
47	0.43
48	0.38
49	0.35
50	0.35
51	0.32
52	0.28
53	0.26
54	0.21
55	0.14
56	0.13
57	0.15
58	0.13
59	0.12
60	0.09
61	0.09
62	0.09
63	0.07
64	0.06
65	0.04
66	0.04
67	0.04
68	0.04
69	0.05
70	0.05
71	0.06
72	0.05
73	0.06
74	0.09
75	0.1
76	0.11
77	0.1
78	0.11
79	0.11
80	0.12
81	0.12
82	0.15
83	0.2
84	0.22
85	0.26
86	0.26
87	0.27
88	0.29
89	0.32
90	0.29
91	0.27
92	0.27
93	0.25
94	0.23
95	0.26
96	0.24
97	0.23
98	0.21
99	0.18
100	0.18
101	0.16
102	0.17
103	0.15
104	0.13
105	0.11
106	0.12
107	0.2
108	0.21
109	0.25
110	0.25
111	0.24
112	0.24
113	0.24
114	0.24
115	0.14
116	0.16
117	0.13
118	0.15
119	0.16
120	0.15
121	0.16
122	0.16
123	0.17
124	0.15
125	0.16
126	0.16
127	0.21
128	0.23
129	0.26
130	0.27
131	0.27
132	0.27
133	0.25
134	0.27
135	0.21
136	0.25
137	0.29
138	0.3
139	0.3
140	0.29
141	0.28
142	0.25
143	0.24
144	0.2
145	0.14
146	0.14
147	0.15
148	0.16
149	0.16
150	0.15
151	0.15
152	0.14
153	0.11
154	0.1
155	0.09
156	0.07
157	0.07
158	0.08
159	0.09
160	0.09
161	0.11
162	0.1
163	0.11
164	0.11
165	0.1
166	0.12
167	0.11
168	0.16
169	0.14
170	0.14
171	0.13
172	0.13
173	0.15
174	0.12
175	0.14
176	0.15
177	0.15
178	0.14
179	0.14
180	0.15
181	0.13
182	0.13
183	0.14
184	0.09
185	0.08
186	0.08
187	0.09
188	0.09
189	0.1
190	0.1
191	0.08
192	0.08
193	0.1
194	0.1
195	0.09
196	0.09
197	0.1
198	0.1
199	0.1
200	0.11
201	0.12
202	0.13
203	0.14
204	0.13
205	0.13
206	0.12
207	0.12
208	0.12
209	0.1
210	0.09
211	0.08
212	0.09
213	0.07
214	0.07
215	0.06
216	0.06
217	0.05
218	0.05
219	0.05
220	0.05
221	0.05
222	0.05
223	0.05
224	0.05
225	0.07
226	0.08
227	0.08
228	0.09
229	0.09
230	0.1
231	0.15
232	0.17
233	0.17
234	0.17
235	0.18
236	0.17
237	0.21
238	0.2
239	0.18
240	0.17
241	0.16
242	0.15
243	0.17
244	0.18
245	0.16
246	0.25
247	0.25
248	0.28
249	0.29
250	0.28
251	0.27
252	0.26
253	0.25
254	0.17
255	0.17
256	0.14
257	0.16
258	0.16
259	0.15
260	0.14
261	0.14
262	0.14
263	0.12
264	0.11
265	0.08
266	0.08
267	0.08
268	0.08
269	0.07
270	0.05
271	0.04
272	0.05
273	0.06
274	0.07
275	0.08
276	0.1
277	0.11
278	0.12
279	0.12
280	0.11
281	0.11
282	0.1
283	0.1
284	0.08
285	0.08
286	0.08
287	0.07
288	0.07
289	0.06
290	0.05
291	0.05
292	0.06
293	0.06
294	0.1
295	0.1
296	0.1
297	0.1
298	0.1
299	0.1
300	0.09
301	0.08
302	0.04
303	0.04
304	0.04
305	0.04
306	0.04
307	0.04
308	0.03
309	0.04
310	0.04
311	0.04
312	0.05
313	0.06
314	0.07
315	0.09
316	0.11
317	0.14
318	0.15
319	0.19
320	0.23
321	0.25
322	0.32
323	0.39
324	0.46
325	0.53
326	0.62
327	0.66
328	0.7
329	0.69
330	0.66
331	0.65
332	0.61
333	0.55
334	0.51
335	0.53
336	0.47
337	0.44
338	0.39
339	0.32
340	0.28
341	0.27
342	0.25
343	0.21
344	0.22
345	0.22
346	0.23
347	0.22
348	0.23
349	0.21
350	0.19
351	0.17
352	0.16
353	0.16
354	0.17
355	0.19
356	0.18
357	0.16
358	0.15
359	0.1
360	0.1
361	0.09
362	0.08
363	0.08
364	0.13
365	0.18
366	0.2
367	0.27
368	0.33
369	0.42
370	0.51
371	0.54
372	0.54
373	0.56
374	0.57
375	0.54
376	0.53
377	0.49
378	0.41
379	0.41
380	0.37
381	0.34
382	0.31
383	0.29
384	0.26
385	0.24
386	0.23
387	0.19
388	0.19
389	0.17
390	0.17
391	0.15
392	0.13
393	0.1
394	0.1
395	0.08
396	0.07
397	0.06
398	0.05
399	0.05
400	0.05
401	0.04
402	0.04
403	0.03
404	0.04
405	0.04
406	0.04
407	0.04
408	0.05
409	0.05
410	0.06
411	0.06
412	0.08
413	0.09
414	0.11
415	0.11
416	0.12
417	0.13
418	0.13
419	0.15
420	0.13
421	0.13
422	0.13
423	0.13
424	0.13
425	0.12
426	0.12
427	0.12
428	0.12
429	0.11
430	0.12
431	0.14
432	0.17
433	0.22
434	0.26
435	0.33
436	0.41
437	0.48
438	0.52
439	0.56
440	0.63
441	0.68
442	0.74
443	0.76
444	0.78
445	0.79
446	0.82
447	0.83
448	0.76
449	0.67
450	0.58
451	0.48
452	0.38
453	0.29
454	0.2
455	0.13
456	0.09
457	0.07
458	0.07
459	0.06
460	0.06
461	0.06
462	0.06
463	0.06
464	0.06
465	0.06

A0A5C3EN61

3D AlphaFold-predicted Structure Viewer