Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3ER67

Protein Details
Accession A0A5C3ER67    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-33DTKTKSSTSTQKRTTKSKKDPAAPKRPLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAKADTKTKSSTSTQKRTTKSKKDPAAPKRPLSAYMFFSQDHRERVKTANPEAGFGDVGRLLGAKWKEMSDAEKKPYLDMANRDKARAEAEKAAYAKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.71
4 0.77
5 0.81
6 0.82
7 0.82
8 0.83
9 0.81
10 0.83
11 0.87
12 0.86
13 0.87
14 0.83
15 0.76
16 0.71
17 0.64
18 0.58
19 0.52
20 0.45
21 0.38
22 0.33
23 0.31
24 0.26
25 0.26
26 0.27
27 0.26
28 0.26
29 0.25
30 0.23
31 0.23
32 0.26
33 0.3
34 0.3
35 0.29
36 0.31
37 0.28
38 0.28
39 0.27
40 0.25
41 0.19
42 0.14
43 0.13
44 0.07
45 0.07
46 0.05
47 0.05
48 0.04
49 0.09
50 0.09
51 0.1
52 0.11
53 0.11
54 0.13
55 0.14
56 0.19
57 0.22
58 0.28
59 0.3
60 0.34
61 0.34
62 0.33
63 0.36
64 0.34
65 0.32
66 0.34
67 0.38
68 0.44
69 0.45
70 0.45
71 0.42
72 0.4
73 0.41
74 0.38
75 0.34
76 0.31
77 0.33
78 0.39
79 0.4