Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SR06

Protein Details
Accession Q8SR06   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
94-125GKEFHVTPRRVRKDERKKRYKIFGTLKRAMKKBasic
NLS Segment(s)
PositionSequence
101-131PRRVRKDERKKRYKIFGTLKRAMKKAERKNK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MSLELEIADLRDNRLLSRKELDVVAYHPGMPIPSKEEIREKISELYQTKKDNVVVMDLKNRYGTHRTTLKAKIYSSIEVLSNIEKKHIVAKLTGKEFHVTPRRVRKDERKKRYKIFGTLKRAMKKAERKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.27
4 0.31
5 0.31
6 0.3
7 0.3
8 0.29
9 0.23
10 0.22
11 0.22
12 0.18
13 0.17
14 0.15
15 0.14
16 0.14
17 0.13
18 0.12
19 0.12
20 0.15
21 0.17
22 0.19
23 0.25
24 0.28
25 0.32
26 0.32
27 0.3
28 0.29
29 0.29
30 0.33
31 0.29
32 0.3
33 0.31
34 0.32
35 0.32
36 0.31
37 0.3
38 0.26
39 0.24
40 0.24
41 0.21
42 0.19
43 0.24
44 0.22
45 0.22
46 0.21
47 0.21
48 0.19
49 0.2
50 0.2
51 0.2
52 0.25
53 0.25
54 0.29
55 0.34
56 0.35
57 0.35
58 0.34
59 0.32
60 0.3
61 0.29
62 0.25
63 0.22
64 0.17
65 0.15
66 0.16
67 0.14
68 0.15
69 0.14
70 0.14
71 0.13
72 0.13
73 0.17
74 0.19
75 0.18
76 0.19
77 0.25
78 0.3
79 0.34
80 0.35
81 0.32
82 0.31
83 0.3
84 0.35
85 0.38
86 0.36
87 0.4
88 0.49
89 0.57
90 0.6
91 0.68
92 0.71
93 0.73
94 0.81
95 0.84
96 0.83
97 0.84
98 0.88
99 0.9
100 0.87
101 0.86
102 0.86
103 0.84
104 0.83
105 0.83
106 0.82
107 0.78
108 0.73
109 0.69
110 0.68
111 0.68