Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3ELC3

Protein Details
Accession A0A5C3ELC3   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
98-123LRTVRPPRYRAPPRRRTRYQSPLPGSHydrophilic
NLS Segment(s)
PositionSequence
107-112RAPPRR
Subcellular Location(s) cyto_nucl 6, extr 6, mito 6, nucl 10
Family & Domain DBs
Amino Acid Sequences MKLNNFFVALALSSGVLTLAAPLPLGGLGDMLRAMVKAGRNGETSVGFIPHETYTFQREARAGEEGRGGFRTVPLPETFIPHKTSNLQREGEEGTGGLRTVRPPRYRAPPRRRTRYQSPLPGSREQFTLAPLPPNRPTYPTHSEAVRGEDILGSPPRSDETIYFDSYDSLGSRRPTAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.04
5 0.05
6 0.06
7 0.05
8 0.06
9 0.05
10 0.06
11 0.06
12 0.06
13 0.04
14 0.04
15 0.04
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.07
23 0.09
24 0.13
25 0.16
26 0.18
27 0.2
28 0.2
29 0.22
30 0.2
31 0.19
32 0.16
33 0.15
34 0.12
35 0.1
36 0.12
37 0.1
38 0.11
39 0.1
40 0.11
41 0.15
42 0.17
43 0.17
44 0.17
45 0.18
46 0.18
47 0.19
48 0.21
49 0.18
50 0.16
51 0.19
52 0.17
53 0.18
54 0.17
55 0.16
56 0.11
57 0.12
58 0.13
59 0.1
60 0.12
61 0.11
62 0.14
63 0.13
64 0.17
65 0.18
66 0.18
67 0.22
68 0.2
69 0.21
70 0.23
71 0.29
72 0.3
73 0.33
74 0.32
75 0.28
76 0.29
77 0.29
78 0.25
79 0.18
80 0.13
81 0.09
82 0.08
83 0.07
84 0.06
85 0.05
86 0.07
87 0.13
88 0.2
89 0.23
90 0.26
91 0.31
92 0.42
93 0.52
94 0.61
95 0.66
96 0.7
97 0.77
98 0.84
99 0.87
100 0.84
101 0.84
102 0.83
103 0.81
104 0.8
105 0.77
106 0.75
107 0.72
108 0.7
109 0.62
110 0.53
111 0.45
112 0.37
113 0.31
114 0.25
115 0.24
116 0.19
117 0.23
118 0.23
119 0.27
120 0.3
121 0.34
122 0.34
123 0.33
124 0.35
125 0.36
126 0.41
127 0.4
128 0.38
129 0.34
130 0.36
131 0.35
132 0.37
133 0.3
134 0.23
135 0.2
136 0.18
137 0.17
138 0.18
139 0.2
140 0.15
141 0.15
142 0.15
143 0.17
144 0.17
145 0.18
146 0.15
147 0.2
148 0.23
149 0.25
150 0.25
151 0.24
152 0.24
153 0.22
154 0.22
155 0.16
156 0.13
157 0.16
158 0.18