FuNGI

A0A5C3DW62

Protein Details

Accession

A0A5C3DW62

Localization Confidence

Low

Confidence Score

8.7

NoLS Segment(s)

Position	Sequence	Protein Nature
24-43	GAPKRTTTQHQQLPPRPKLN	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 13.5, cyto_nucl 11.5, cyto 8.5, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR029063 SAM-dependent_MTases_sf IPR011671 tRNA_uracil_MeTrfase
Gene Ontology	GO:0005737 C:cytoplasm GO:0016300 F:tRNA (uracil) methyltransferase activity
Pfam	View protein in Pfam PF07757 AdoMet_MTase

Amino Acid Sequences

MSSSTDAECSTSISARSNSSIQNGAPKRTTTQHQQLPPRPKLNPAYPSAESPVAPSCSSANNDDATRLPFALSGLLKSTGEEKMEEYAWISVITAPAYAPMTSWLAVMQSLIRHPERNSSNILRADVVSESEPSQAEQQGWRKQWTIRRALLPRRPNLDWRMEQDCSLYYKYQRGGEGHEEEDEDVAEAVVIYTPLIGTLSHPKMEQEQVEVMGQPPQRETSIPFYHPKVRALAFHFRLSSPSSSPSASSDTNTMFGSLGISLIPFPQTPSNRSKNEAEASEGAYPPTHRLSRVALSLITTLHMHTWGHLHSYQKRVHHDTVVPRELYQDLYLELKRKYAGELISNWAEATDPTKHVFEEMGIAAFLISLWSLTYKGKDKEQGEGEEWKNKVKFVDVGCGNGLLTYILSREGFRGVGLDLRSRKSWTAYTSNGAQLSEWTFNPSTLVQPPSSTDSSSCSSIWTGAWLLGNHADELTPWLPVLATHHTAAGFINLPCCYFSLDGTRAFPLLLKGGREVSRNEQYLAYVGELHKRFGWQVDLEPLRIPSTKNWCFVGRTRIETEAGEEGLKQKVKDAVEQAMASGWAARACSK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.22
2	0.23
3	0.27
4	0.28
5	0.29
6	0.3
7	0.32
8	0.29
9	0.37
10	0.39
11	0.41
12	0.41
13	0.4
14	0.41
15	0.44
16	0.49
17	0.49
18	0.55
19	0.58
20	0.62
21	0.71
22	0.76
23	0.8
24	0.82
25	0.8
26	0.71
27	0.71
28	0.71
29	0.69
30	0.66
31	0.61
32	0.59
33	0.54
34	0.55
35	0.51
36	0.45
37	0.36
38	0.32
39	0.32
40	0.27
41	0.25
42	0.23
43	0.2
44	0.23
45	0.25
46	0.26
47	0.23
48	0.23
49	0.24
50	0.24
51	0.25
52	0.23
53	0.22
54	0.2
55	0.17
56	0.15
57	0.15
58	0.18
59	0.16
60	0.15
61	0.15
62	0.17
63	0.17
64	0.17
65	0.19
66	0.17
67	0.17
68	0.17
69	0.16
70	0.17
71	0.17
72	0.17
73	0.15
74	0.13
75	0.13
76	0.12
77	0.11
78	0.09
79	0.09
80	0.09
81	0.08
82	0.07
83	0.09
84	0.1
85	0.09
86	0.08
87	0.1
88	0.12
89	0.11
90	0.12
91	0.1
92	0.09
93	0.09
94	0.1
95	0.09
96	0.09
97	0.1
98	0.16
99	0.17
100	0.2
101	0.21
102	0.3
103	0.32
104	0.33
105	0.39
106	0.38
107	0.43
108	0.42
109	0.42
110	0.35
111	0.31
112	0.3
113	0.23
114	0.2
115	0.14
116	0.13
117	0.12
118	0.13
119	0.13
120	0.12
121	0.14
122	0.14
123	0.15
124	0.2
125	0.27
126	0.33
127	0.36
128	0.38
129	0.39
130	0.43
131	0.49
132	0.52
133	0.52
134	0.5
135	0.56
136	0.61
137	0.68
138	0.72
139	0.72
140	0.7
141	0.68
142	0.65
143	0.62
144	0.59
145	0.58
146	0.52
147	0.49
148	0.49
149	0.43
150	0.41
151	0.36
152	0.32
153	0.27
154	0.26
155	0.23
156	0.19
157	0.24
158	0.27
159	0.28
160	0.3
161	0.27
162	0.3
163	0.34
164	0.35
165	0.31
166	0.28
167	0.26
168	0.22
169	0.21
170	0.16
171	0.1
172	0.07
173	0.05
174	0.04
175	0.04
176	0.04
177	0.03
178	0.03
179	0.03
180	0.03
181	0.03
182	0.03
183	0.03
184	0.03
185	0.05
186	0.14
187	0.15
188	0.16
189	0.17
190	0.18
191	0.2
192	0.23
193	0.22
194	0.17
195	0.16
196	0.16
197	0.17
198	0.16
199	0.14
200	0.16
201	0.16
202	0.14
203	0.14
204	0.14
205	0.15
206	0.15
207	0.18
208	0.2
209	0.24
210	0.26
211	0.29
212	0.31
213	0.38
214	0.39
215	0.38
216	0.33
217	0.3
218	0.31
219	0.33
220	0.39
221	0.34
222	0.35
223	0.34
224	0.3
225	0.31
226	0.29
227	0.26
228	0.18
229	0.18
230	0.18
231	0.17
232	0.17
233	0.17
234	0.18
235	0.17
236	0.16
237	0.16
238	0.15
239	0.16
240	0.15
241	0.14
242	0.1
243	0.09
244	0.09
245	0.06
246	0.06
247	0.04
248	0.04
249	0.04
250	0.04
251	0.05
252	0.04
253	0.06
254	0.11
255	0.13
256	0.17
257	0.25
258	0.32
259	0.33
260	0.37
261	0.37
262	0.36
263	0.37
264	0.34
265	0.29
266	0.23
267	0.23
268	0.21
269	0.19
270	0.15
271	0.12
272	0.12
273	0.11
274	0.13
275	0.12
276	0.11
277	0.12
278	0.15
279	0.17
280	0.18
281	0.17
282	0.13
283	0.13
284	0.13
285	0.12
286	0.1
287	0.08
288	0.07
289	0.06
290	0.07
291	0.06
292	0.06
293	0.08
294	0.07
295	0.1
296	0.12
297	0.16
298	0.19
299	0.26
300	0.29
301	0.32
302	0.37
303	0.4
304	0.4
305	0.39
306	0.4
307	0.41
308	0.45
309	0.44
310	0.38
311	0.32
312	0.32
313	0.29
314	0.26
315	0.18
316	0.11
317	0.08
318	0.11
319	0.12
320	0.14
321	0.14
322	0.14
323	0.14
324	0.14
325	0.15
326	0.15
327	0.16
328	0.15
329	0.17
330	0.19
331	0.19
332	0.19
333	0.17
334	0.14
335	0.12
336	0.1
337	0.11
338	0.09
339	0.1
340	0.12
341	0.13
342	0.12
343	0.13
344	0.13
345	0.1
346	0.1
347	0.09
348	0.08
349	0.07
350	0.07
351	0.06
352	0.06
353	0.06
354	0.03
355	0.03
356	0.02
357	0.02
358	0.03
359	0.05
360	0.06
361	0.09
362	0.15
363	0.17
364	0.21
365	0.28
366	0.29
367	0.34
368	0.38
369	0.38
370	0.35
371	0.4
372	0.38
373	0.37
374	0.37
375	0.36
376	0.32
377	0.3
378	0.27
379	0.22
380	0.25
381	0.2
382	0.29
383	0.24
384	0.25
385	0.24
386	0.24
387	0.22
388	0.17
389	0.15
390	0.07
391	0.06
392	0.04
393	0.04
394	0.06
395	0.06
396	0.07
397	0.07
398	0.09
399	0.09
400	0.08
401	0.09
402	0.08
403	0.11
404	0.12
405	0.17
406	0.19
407	0.22
408	0.23
409	0.25
410	0.25
411	0.25
412	0.28
413	0.27
414	0.31
415	0.31
416	0.33
417	0.34
418	0.36
419	0.33
420	0.3
421	0.24
422	0.19
423	0.2
424	0.19
425	0.16
426	0.17
427	0.17
428	0.17
429	0.18
430	0.17
431	0.17
432	0.19
433	0.22
434	0.18
435	0.18
436	0.21
437	0.25
438	0.25
439	0.23
440	0.19
441	0.2
442	0.23
443	0.24
444	0.22
445	0.18
446	0.17
447	0.17
448	0.16
449	0.14
450	0.12
451	0.11
452	0.14
453	0.13
454	0.14
455	0.16
456	0.16
457	0.15
458	0.14
459	0.12
460	0.1
461	0.15
462	0.14
463	0.11
464	0.1
465	0.1
466	0.1
467	0.1
468	0.14
469	0.14
470	0.16
471	0.17
472	0.18
473	0.18
474	0.18
475	0.18
476	0.16
477	0.14
478	0.12
479	0.14
480	0.13
481	0.14
482	0.14
483	0.15
484	0.15
485	0.13
486	0.14
487	0.19
488	0.21
489	0.23
490	0.25
491	0.25
492	0.23
493	0.22
494	0.22
495	0.16
496	0.18
497	0.19
498	0.18
499	0.19
500	0.24
501	0.27
502	0.29
503	0.31
504	0.34
505	0.4
506	0.4
507	0.4
508	0.35
509	0.33
510	0.32
511	0.29
512	0.22
513	0.17
514	0.16
515	0.23
516	0.24
517	0.25
518	0.24
519	0.24
520	0.25
521	0.24
522	0.28
523	0.22
524	0.24
525	0.32
526	0.33
527	0.32
528	0.33
529	0.31
530	0.29
531	0.29
532	0.28
533	0.26
534	0.34
535	0.39
536	0.41
537	0.43
538	0.43
539	0.47
540	0.51
541	0.53
542	0.49
543	0.49
544	0.49
545	0.48
546	0.47
547	0.42
548	0.39
549	0.32
550	0.27
551	0.22
552	0.19
553	0.18
554	0.23
555	0.26
556	0.22
557	0.23
558	0.27
559	0.29
560	0.34
561	0.37
562	0.36
563	0.38
564	0.38
565	0.34
566	0.29
567	0.28
568	0.21
569	0.18
570	0.13
571	0.1

A0A5C3DW62

3D AlphaFold-predicted Structure Viewer