Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3EA85

Protein Details
Accession A0A5C3EA85    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-93ASKAEETKKKKEQGKVEQNKSDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 9.833, cysk 8, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043171  Ap4A_phos1/2-like  
IPR045759  Ap4A_phos1/2_N  
IPR019200  ATP_adenylylTrfase_C  
IPR036265  HIT-like_sf  
Gene Ontology GO:0003877  F:ATP adenylyltransferase activity  
Pfam View protein in Pfam  
PF19327  Ap4A_phos_N  
PF09830  ATP_transf  
Amino Acid Sequences MPIPDSDLKSLASEVKSKFDVAIADGDAFFYPSEKITLQESEASGVLWQIRTVPALLKKPKATASSNSDTDASKAEETKKKKEQGKVEQNKSDVFAPPYVPNLLVKELGEHVMLLNKFCVVPQHFLMVTREFASQDLPPSPETLTLAYRIVSAHRPGGSNTELLAFYNCGATAGASQPHRHLQFVQCPPLDTTSPEAISSHRLSEEDQDKIVESDYKVPVESLLERIEKDGKEEDSVHALPLPWQHFVALLNPTAAMKKDEGEMERYIGNKFMGLLDALFRARMFAQAEGKEASGRPAFNVLITKRAMHLIPRSREEYTDLPGKGDAEGKIGNLSINSLGYAGFMLSRSIEEQEALKSVQGGVEEVLKVTGVAPVEDVTVQAGLPTTNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.31
4 0.31
5 0.29
6 0.26
7 0.24
8 0.19
9 0.21
10 0.17
11 0.17
12 0.16
13 0.16
14 0.14
15 0.14
16 0.12
17 0.09
18 0.09
19 0.09
20 0.12
21 0.11
22 0.12
23 0.15
24 0.18
25 0.18
26 0.21
27 0.21
28 0.2
29 0.2
30 0.18
31 0.15
32 0.14
33 0.14
34 0.11
35 0.1
36 0.1
37 0.11
38 0.12
39 0.13
40 0.17
41 0.22
42 0.31
43 0.37
44 0.42
45 0.44
46 0.47
47 0.52
48 0.52
49 0.5
50 0.48
51 0.5
52 0.5
53 0.49
54 0.47
55 0.43
56 0.38
57 0.34
58 0.29
59 0.23
60 0.18
61 0.2
62 0.27
63 0.33
64 0.38
65 0.47
66 0.53
67 0.59
68 0.65
69 0.69
70 0.71
71 0.75
72 0.81
73 0.82
74 0.82
75 0.79
76 0.73
77 0.66
78 0.58
79 0.49
80 0.41
81 0.33
82 0.26
83 0.23
84 0.22
85 0.23
86 0.22
87 0.2
88 0.18
89 0.17
90 0.17
91 0.16
92 0.14
93 0.14
94 0.14
95 0.14
96 0.13
97 0.1
98 0.09
99 0.13
100 0.13
101 0.12
102 0.11
103 0.11
104 0.11
105 0.11
106 0.17
107 0.14
108 0.17
109 0.18
110 0.21
111 0.21
112 0.23
113 0.25
114 0.21
115 0.19
116 0.17
117 0.17
118 0.14
119 0.14
120 0.14
121 0.12
122 0.13
123 0.14
124 0.14
125 0.13
126 0.14
127 0.14
128 0.13
129 0.13
130 0.13
131 0.12
132 0.12
133 0.12
134 0.11
135 0.11
136 0.1
137 0.11
138 0.12
139 0.13
140 0.15
141 0.16
142 0.16
143 0.16
144 0.2
145 0.19
146 0.17
147 0.15
148 0.14
149 0.13
150 0.12
151 0.12
152 0.08
153 0.07
154 0.07
155 0.07
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.1
162 0.1
163 0.11
164 0.13
165 0.18
166 0.19
167 0.19
168 0.2
169 0.21
170 0.29
171 0.32
172 0.36
173 0.31
174 0.32
175 0.32
176 0.31
177 0.27
178 0.19
179 0.19
180 0.15
181 0.15
182 0.14
183 0.13
184 0.12
185 0.16
186 0.15
187 0.12
188 0.11
189 0.11
190 0.12
191 0.18
192 0.2
193 0.17
194 0.16
195 0.16
196 0.16
197 0.16
198 0.15
199 0.11
200 0.09
201 0.13
202 0.14
203 0.14
204 0.14
205 0.14
206 0.14
207 0.13
208 0.13
209 0.1
210 0.12
211 0.12
212 0.12
213 0.14
214 0.18
215 0.16
216 0.18
217 0.19
218 0.17
219 0.18
220 0.19
221 0.18
222 0.19
223 0.19
224 0.17
225 0.15
226 0.14
227 0.14
228 0.17
229 0.18
230 0.14
231 0.14
232 0.14
233 0.14
234 0.14
235 0.16
236 0.13
237 0.11
238 0.11
239 0.11
240 0.11
241 0.11
242 0.11
243 0.1
244 0.09
245 0.09
246 0.11
247 0.14
248 0.15
249 0.18
250 0.18
251 0.17
252 0.18
253 0.18
254 0.17
255 0.16
256 0.14
257 0.11
258 0.1
259 0.09
260 0.08
261 0.07
262 0.07
263 0.07
264 0.08
265 0.08
266 0.08
267 0.08
268 0.08
269 0.08
270 0.11
271 0.12
272 0.13
273 0.19
274 0.19
275 0.22
276 0.22
277 0.22
278 0.2
279 0.19
280 0.2
281 0.17
282 0.16
283 0.15
284 0.17
285 0.17
286 0.17
287 0.24
288 0.2
289 0.22
290 0.23
291 0.23
292 0.21
293 0.23
294 0.22
295 0.21
296 0.29
297 0.34
298 0.39
299 0.43
300 0.46
301 0.44
302 0.45
303 0.45
304 0.38
305 0.34
306 0.36
307 0.31
308 0.28
309 0.28
310 0.27
311 0.24
312 0.24
313 0.2
314 0.16
315 0.16
316 0.15
317 0.16
318 0.15
319 0.15
320 0.11
321 0.12
322 0.09
323 0.09
324 0.09
325 0.08
326 0.08
327 0.07
328 0.07
329 0.06
330 0.06
331 0.06
332 0.06
333 0.07
334 0.08
335 0.09
336 0.11
337 0.12
338 0.12
339 0.13
340 0.14
341 0.16
342 0.16
343 0.14
344 0.13
345 0.13
346 0.13
347 0.12
348 0.12
349 0.1
350 0.13
351 0.13
352 0.12
353 0.12
354 0.1
355 0.1
356 0.09
357 0.11
358 0.08
359 0.08
360 0.09
361 0.09
362 0.11
363 0.1
364 0.1
365 0.09
366 0.09
367 0.08
368 0.08
369 0.08