Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VPV4

Protein Details
Accession H1VPV4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-41GDSCPFPRKKRSKSHGPWPMGHydrophilic
NLS Segment(s)
PositionSequence
28-34RKKRSKS
Subcellular Location(s) mito 15, cyto_mito 10.833, nucl 6.5, cyto_nucl 6.166, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLFFPRHVPGLSPPFQRSNRGDSCPFPRKKRSKSHGPWPMGAKSRTMSFPLILSFPSTPTLIPQGVCLSVKHAKAYSSLPNSVRSQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.53
4 0.49
5 0.49
6 0.49
7 0.49
8 0.49
9 0.45
10 0.52
11 0.55
12 0.59
13 0.57
14 0.62
15 0.67
16 0.72
17 0.79
18 0.77
19 0.79
20 0.8
21 0.83
22 0.82
23 0.76
24 0.71
25 0.64
26 0.6
27 0.54
28 0.47
29 0.37
30 0.29
31 0.27
32 0.24
33 0.22
34 0.18
35 0.13
36 0.13
37 0.13
38 0.12
39 0.11
40 0.12
41 0.1
42 0.1
43 0.11
44 0.11
45 0.1
46 0.11
47 0.14
48 0.13
49 0.13
50 0.13
51 0.13
52 0.15
53 0.16
54 0.14
55 0.17
56 0.21
57 0.22
58 0.24
59 0.23
60 0.23
61 0.25
62 0.29
63 0.32
64 0.32
65 0.37
66 0.36
67 0.41