Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3E6R5

Protein Details
Accession A0A5C3E6R5    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
334-355QEKVDRMRRRELRVVQSKREIEHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 18, nucl 4.5, cyto_nucl 4, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013749  PM/HMP-P_kinase-1  
IPR004625  PyrdxlKinase  
IPR029056  Ribokinase-like  
Gene Ontology GO:0008478  F:pyridoxal kinase activity  
GO:0016310  P:phosphorylation  
GO:0009443  P:pyridoxal 5'-phosphate salvage  
Pfam View protein in Pfam  
PF08543  Phos_pyr_kin  
CDD cd01173  pyridoxal_pyridoxamine_kinase  
Amino Acid Sequences MAANVPDPSRILSIQSHVVSGYVGNRSATFPLQLLGWDVDVTNTVQFSNHTGYGRWGGLRFDAEHLQDIFSGLEKNGLLRYSRMLTGYMPSAAVVKTVLELVKKLRSRSGGEEGGLIYLLDPVMGDMGRGMYVAPEVLPIYREMLQFSTIITPNQFEAQALTGIDITDLPSLKKVLWTLHTQHKVPHVIITSVELPDEDLEKIGAHRSLPDGRLAMLQVGSSCEITLDSKGERQEPSLSVEELEIWSIQFPEVQGYFSGVGDMFAALTLGRFHPEAEESARSNGVGKKPLTPIAKASELAIASLQGILSNTCKVIDELEKELPPPGAEAKDEAQEKVDRMRRRELRVVQSKREIETPTIVYCAKWISG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.26
4 0.23
5 0.23
6 0.19
7 0.18
8 0.19
9 0.15
10 0.15
11 0.15
12 0.16
13 0.18
14 0.2
15 0.2
16 0.18
17 0.15
18 0.15
19 0.14
20 0.13
21 0.15
22 0.13
23 0.12
24 0.11
25 0.1
26 0.1
27 0.11
28 0.11
29 0.09
30 0.09
31 0.08
32 0.09
33 0.09
34 0.13
35 0.16
36 0.19
37 0.19
38 0.19
39 0.22
40 0.26
41 0.27
42 0.25
43 0.22
44 0.19
45 0.21
46 0.22
47 0.21
48 0.2
49 0.22
50 0.21
51 0.24
52 0.23
53 0.21
54 0.19
55 0.18
56 0.15
57 0.12
58 0.12
59 0.09
60 0.1
61 0.1
62 0.11
63 0.12
64 0.13
65 0.13
66 0.13
67 0.17
68 0.17
69 0.18
70 0.18
71 0.17
72 0.17
73 0.18
74 0.19
75 0.16
76 0.13
77 0.11
78 0.12
79 0.11
80 0.1
81 0.08
82 0.06
83 0.06
84 0.08
85 0.09
86 0.08
87 0.09
88 0.12
89 0.2
90 0.23
91 0.24
92 0.27
93 0.3
94 0.34
95 0.38
96 0.42
97 0.37
98 0.34
99 0.34
100 0.29
101 0.25
102 0.21
103 0.15
104 0.08
105 0.06
106 0.05
107 0.04
108 0.03
109 0.03
110 0.04
111 0.04
112 0.03
113 0.03
114 0.04
115 0.04
116 0.04
117 0.04
118 0.03
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.08
128 0.11
129 0.11
130 0.11
131 0.12
132 0.13
133 0.12
134 0.13
135 0.14
136 0.12
137 0.12
138 0.11
139 0.11
140 0.11
141 0.12
142 0.11
143 0.08
144 0.08
145 0.08
146 0.08
147 0.07
148 0.07
149 0.06
150 0.06
151 0.06
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.07
158 0.07
159 0.07
160 0.09
161 0.09
162 0.1
163 0.12
164 0.16
165 0.2
166 0.28
167 0.32
168 0.31
169 0.32
170 0.35
171 0.34
172 0.31
173 0.29
174 0.21
175 0.18
176 0.17
177 0.17
178 0.14
179 0.11
180 0.11
181 0.08
182 0.07
183 0.07
184 0.08
185 0.06
186 0.05
187 0.05
188 0.05
189 0.06
190 0.07
191 0.07
192 0.06
193 0.07
194 0.1
195 0.13
196 0.13
197 0.14
198 0.13
199 0.13
200 0.14
201 0.14
202 0.11
203 0.08
204 0.08
205 0.06
206 0.07
207 0.07
208 0.06
209 0.06
210 0.05
211 0.06
212 0.07
213 0.07
214 0.08
215 0.08
216 0.11
217 0.13
218 0.15
219 0.16
220 0.17
221 0.19
222 0.19
223 0.23
224 0.22
225 0.2
226 0.18
227 0.17
228 0.16
229 0.13
230 0.12
231 0.08
232 0.06
233 0.06
234 0.06
235 0.06
236 0.06
237 0.06
238 0.08
239 0.08
240 0.09
241 0.09
242 0.1
243 0.11
244 0.1
245 0.11
246 0.08
247 0.08
248 0.07
249 0.07
250 0.05
251 0.04
252 0.04
253 0.03
254 0.04
255 0.05
256 0.05
257 0.06
258 0.07
259 0.07
260 0.09
261 0.1
262 0.12
263 0.15
264 0.18
265 0.18
266 0.2
267 0.2
268 0.18
269 0.21
270 0.23
271 0.24
272 0.27
273 0.26
274 0.3
275 0.33
276 0.4
277 0.4
278 0.36
279 0.36
280 0.35
281 0.37
282 0.32
283 0.29
284 0.26
285 0.23
286 0.21
287 0.17
288 0.12
289 0.1
290 0.1
291 0.09
292 0.06
293 0.06
294 0.07
295 0.08
296 0.09
297 0.09
298 0.1
299 0.11
300 0.1
301 0.14
302 0.18
303 0.2
304 0.24
305 0.29
306 0.29
307 0.28
308 0.3
309 0.27
310 0.22
311 0.2
312 0.19
313 0.16
314 0.17
315 0.19
316 0.2
317 0.25
318 0.27
319 0.25
320 0.25
321 0.26
322 0.27
323 0.33
324 0.38
325 0.39
326 0.43
327 0.53
328 0.57
329 0.63
330 0.71
331 0.7
332 0.74
333 0.78
334 0.81
335 0.78
336 0.8
337 0.76
338 0.68
339 0.65
340 0.57
341 0.5
342 0.48
343 0.43
344 0.35
345 0.35
346 0.32
347 0.27
348 0.25