Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3E5D6

Protein Details
Accession A0A5C3E5D6    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MVERERGRRGKAKSKNSSQHNQVRKHydrophilic
NLS Segment(s)
PositionSequence
5-43ERGRRGKAKSKNSSQHNQVRKAHRNGIKKPKTNKYPSLR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MVERERGRRGKAKSKNSSQHNQVRKAHRNGIKKPKTNKYPSLRGVDPKFVRNQRYAKHGTEKALKAARAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.82
4 0.83
5 0.81
6 0.81
7 0.78
8 0.76
9 0.74
10 0.75
11 0.76
12 0.73
13 0.73
14 0.71
15 0.71
16 0.72
17 0.76
18 0.75
19 0.73
20 0.76
21 0.76
22 0.77
23 0.75
24 0.75
25 0.72
26 0.71
27 0.69
28 0.67
29 0.6
30 0.58
31 0.54
32 0.54
33 0.49
34 0.44
35 0.47
36 0.46
37 0.48
38 0.48
39 0.52
40 0.46
41 0.53
42 0.54
43 0.52
44 0.56
45 0.55
46 0.55
47 0.57
48 0.56
49 0.56
50 0.56
51 0.52