Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3EK07

Protein Details
Accession A0A5C3EK07   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
275-295FPYVKRVGEYKEKKQRSKKTLHydrophilic
NLS Segment(s)
PositionSequence
288-288K
290-290R
Subcellular Location(s) cyto 4, cyto_mito 4, extr 5, mito 4, plas 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR008901  ACER  
Gene Ontology GO:0016020  C:membrane  
GO:0016811  F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides  
GO:0006672  P:ceramide metabolic process  
Pfam View protein in Pfam  
PF05875  Ceramidase  
Amino Acid Sequences MSWYQPPTPPPVGYWGPITSTLQWCETKYAFSHYIAEPVNTLTNIFFILLSLYGYRVTRQQRLPLRYSICHLGVALVGFGSAWFHATLTYSTQLLDELPMIYTSAWLTYCVCETQRAYAKPRFRLLLPTSLILLVVCITVVYLRNGNPVFHQVAYASIQIASTLRVIHLLRNPSSYLNTTSIGKIRKSQIQNLYLFGAIIFLTGFAIWNVDNIFCYNLTQARHKVGYPWAVLLEGHGWWHILTGWGAYCLITAGTQLAVGEKQGAENFELVDGWFPYVKRVGEYKEKKQRSKKTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.29
3 0.27
4 0.28
5 0.29
6 0.27
7 0.29
8 0.3
9 0.3
10 0.31
11 0.3
12 0.33
13 0.31
14 0.29
15 0.26
16 0.31
17 0.29
18 0.28
19 0.32
20 0.27
21 0.32
22 0.3
23 0.29
24 0.23
25 0.22
26 0.22
27 0.18
28 0.18
29 0.11
30 0.11
31 0.11
32 0.1
33 0.08
34 0.06
35 0.07
36 0.06
37 0.07
38 0.07
39 0.07
40 0.09
41 0.09
42 0.1
43 0.16
44 0.22
45 0.28
46 0.32
47 0.4
48 0.47
49 0.53
50 0.57
51 0.57
52 0.57
53 0.51
54 0.51
55 0.47
56 0.39
57 0.33
58 0.29
59 0.22
60 0.17
61 0.16
62 0.12
63 0.06
64 0.05
65 0.04
66 0.04
67 0.04
68 0.03
69 0.04
70 0.04
71 0.04
72 0.05
73 0.06
74 0.07
75 0.09
76 0.11
77 0.1
78 0.1
79 0.1
80 0.1
81 0.09
82 0.09
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.07
95 0.07
96 0.08
97 0.09
98 0.1
99 0.12
100 0.12
101 0.18
102 0.24
103 0.26
104 0.31
105 0.37
106 0.42
107 0.44
108 0.46
109 0.42
110 0.35
111 0.4
112 0.37
113 0.38
114 0.33
115 0.29
116 0.27
117 0.25
118 0.24
119 0.15
120 0.13
121 0.06
122 0.04
123 0.03
124 0.03
125 0.02
126 0.03
127 0.04
128 0.05
129 0.06
130 0.06
131 0.11
132 0.12
133 0.12
134 0.12
135 0.14
136 0.15
137 0.14
138 0.14
139 0.09
140 0.1
141 0.12
142 0.11
143 0.08
144 0.07
145 0.07
146 0.07
147 0.07
148 0.06
149 0.05
150 0.05
151 0.05
152 0.08
153 0.08
154 0.11
155 0.15
156 0.18
157 0.18
158 0.2
159 0.21
160 0.19
161 0.21
162 0.2
163 0.19
164 0.17
165 0.18
166 0.17
167 0.18
168 0.21
169 0.22
170 0.21
171 0.23
172 0.25
173 0.32
174 0.34
175 0.4
176 0.44
177 0.47
178 0.47
179 0.44
180 0.41
181 0.33
182 0.29
183 0.21
184 0.14
185 0.08
186 0.06
187 0.05
188 0.03
189 0.04
190 0.04
191 0.04
192 0.03
193 0.04
194 0.04
195 0.05
196 0.06
197 0.06
198 0.06
199 0.07
200 0.08
201 0.08
202 0.08
203 0.1
204 0.13
205 0.15
206 0.2
207 0.22
208 0.26
209 0.28
210 0.27
211 0.29
212 0.31
213 0.34
214 0.29
215 0.28
216 0.23
217 0.22
218 0.21
219 0.19
220 0.15
221 0.09
222 0.09
223 0.08
224 0.08
225 0.07
226 0.08
227 0.07
228 0.07
229 0.07
230 0.08
231 0.08
232 0.09
233 0.09
234 0.08
235 0.08
236 0.07
237 0.07
238 0.06
239 0.06
240 0.05
241 0.05
242 0.06
243 0.06
244 0.07
245 0.07
246 0.07
247 0.09
248 0.08
249 0.1
250 0.11
251 0.13
252 0.13
253 0.13
254 0.13
255 0.12
256 0.12
257 0.1
258 0.11
259 0.1
260 0.11
261 0.13
262 0.12
263 0.15
264 0.2
265 0.2
266 0.22
267 0.26
268 0.31
269 0.4
270 0.48
271 0.56
272 0.62
273 0.71
274 0.78
275 0.84