Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K1Q8

Protein Details
Accession A0A5M9K1Q8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
13-32EGPVCPPHPRRRPTRESDEEBasic
NLS Segment(s)
Subcellular Location(s) cyto 7.5, cyto_nucl 12, mito 2, nucl 15.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MLLFYHDEEEHTEGPVCPPHPRRRPTRESDEEWAQRLMEWEALKSQVLKVKPKGNAMTQKYYVDKILPHYINVIEELRTTDPTVEWLLMEDGDGSHGFRKYGLAQQLRDAHNIKNLSHPLNHPISIPLRQFGIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.21
4 0.25
5 0.33
6 0.42
7 0.5
8 0.58
9 0.66
10 0.71
11 0.79
12 0.79
13 0.81
14 0.78
15 0.75
16 0.74
17 0.73
18 0.66
19 0.59
20 0.51
21 0.41
22 0.33
23 0.28
24 0.22
25 0.17
26 0.14
27 0.13
28 0.13
29 0.14
30 0.14
31 0.13
32 0.14
33 0.15
34 0.18
35 0.23
36 0.27
37 0.33
38 0.36
39 0.4
40 0.41
41 0.43
42 0.49
43 0.48
44 0.48
45 0.44
46 0.43
47 0.39
48 0.37
49 0.31
50 0.23
51 0.19
52 0.17
53 0.22
54 0.2
55 0.19
56 0.19
57 0.18
58 0.17
59 0.18
60 0.15
61 0.08
62 0.08
63 0.1
64 0.1
65 0.1
66 0.1
67 0.09
68 0.09
69 0.1
70 0.11
71 0.09
72 0.08
73 0.08
74 0.08
75 0.07
76 0.07
77 0.05
78 0.05
79 0.06
80 0.06
81 0.06
82 0.08
83 0.09
84 0.09
85 0.09
86 0.11
87 0.13
88 0.19
89 0.26
90 0.29
91 0.29
92 0.36
93 0.43
94 0.43
95 0.45
96 0.41
97 0.35
98 0.37
99 0.38
100 0.32
101 0.33
102 0.36
103 0.34
104 0.36
105 0.37
106 0.37
107 0.39
108 0.39
109 0.32
110 0.32
111 0.33
112 0.36
113 0.36
114 0.3