Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K159

Protein Details
Accession A0A5M9K159    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
134-153LEDRKIGRLKGRKEERKTEGBasic
NLS Segment(s)
PositionSequence
138-150KIGRLKGRKEERK
Subcellular Location(s) nucl 10, mito 8, cyto_nucl 8, cyto 4, golg 2
Family & Domain DBs
Amino Acid Sequences MYSVQQIRLLHSFPAQQDLRHFGQTHIRHFHLSNFFFYSIKTFSGLCAWRRLFIVSNTQYSTVCECFGDSIQIPKMKRFHTTLFLLLTLQLHLSCQLYLIVATSSLIFHSINSIRYFESSVRSACIFSYFILTLEDRKIGRLKGRKEERKTEGLRNHHGMWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.27
4 0.29
5 0.34
6 0.34
7 0.34
8 0.34
9 0.28
10 0.37
11 0.4
12 0.44
13 0.44
14 0.43
15 0.41
16 0.41
17 0.46
18 0.45
19 0.41
20 0.37
21 0.34
22 0.34
23 0.31
24 0.3
25 0.26
26 0.19
27 0.18
28 0.16
29 0.12
30 0.12
31 0.18
32 0.22
33 0.2
34 0.27
35 0.27
36 0.27
37 0.28
38 0.28
39 0.25
40 0.23
41 0.31
42 0.25
43 0.28
44 0.27
45 0.27
46 0.26
47 0.24
48 0.25
49 0.16
50 0.14
51 0.11
52 0.1
53 0.1
54 0.1
55 0.11
56 0.08
57 0.1
58 0.13
59 0.17
60 0.17
61 0.2
62 0.24
63 0.23
64 0.26
65 0.27
66 0.27
67 0.28
68 0.29
69 0.27
70 0.23
71 0.22
72 0.19
73 0.16
74 0.14
75 0.09
76 0.07
77 0.05
78 0.05
79 0.05
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.05
88 0.04
89 0.05
90 0.04
91 0.04
92 0.04
93 0.06
94 0.05
95 0.05
96 0.09
97 0.11
98 0.14
99 0.15
100 0.16
101 0.16
102 0.17
103 0.19
104 0.15
105 0.18
106 0.17
107 0.17
108 0.18
109 0.18
110 0.17
111 0.16
112 0.17
113 0.14
114 0.12
115 0.15
116 0.13
117 0.13
118 0.15
119 0.15
120 0.15
121 0.16
122 0.2
123 0.16
124 0.19
125 0.22
126 0.24
127 0.32
128 0.39
129 0.45
130 0.52
131 0.63
132 0.7
133 0.74
134 0.81
135 0.78
136 0.8
137 0.78
138 0.77
139 0.75
140 0.73
141 0.73
142 0.69