Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VVJ8

Protein Details
Accession H1VVJ8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
103-123VEKRERGGRRRGRGRERPAINBasic
NLS Segment(s)
PositionSequence
106-122EKRERGGRRRGRGRERP
Subcellular Location(s) extr 12, mito 7, nucl 5.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MCRLVLFAGTCVRCNESLTWADLSQHLSCLEAKNADSFGGXRRGVDVETHPFDQECDACAGEDEGVAGMDFGGQQYQQYQQALASSLSASRSSGKRSGGAAXVVVEKRERGGRRRGRGRERPAINDKDKDNESNWEYALYYRARRFGVQEDSDWLRDTGNRRSLLHYGTIIIIIIRRAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.22
4 0.23
5 0.25
6 0.25
7 0.23
8 0.23
9 0.22
10 0.25
11 0.2
12 0.2
13 0.17
14 0.15
15 0.16
16 0.18
17 0.18
18 0.16
19 0.16
20 0.17
21 0.17
22 0.16
23 0.16
24 0.15
25 0.15
26 0.18
27 0.18
28 0.16
29 0.17
30 0.18
31 0.18
32 0.19
33 0.22
34 0.2
35 0.21
36 0.21
37 0.2
38 0.19
39 0.19
40 0.17
41 0.13
42 0.11
43 0.1
44 0.1
45 0.1
46 0.1
47 0.08
48 0.07
49 0.06
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.06
63 0.08
64 0.09
65 0.09
66 0.09
67 0.1
68 0.11
69 0.1
70 0.08
71 0.06
72 0.07
73 0.07
74 0.07
75 0.07
76 0.09
77 0.1
78 0.13
79 0.16
80 0.16
81 0.17
82 0.18
83 0.19
84 0.17
85 0.16
86 0.13
87 0.13
88 0.14
89 0.13
90 0.13
91 0.11
92 0.11
93 0.16
94 0.2
95 0.22
96 0.31
97 0.39
98 0.48
99 0.58
100 0.67
101 0.72
102 0.79
103 0.82
104 0.81
105 0.76
106 0.74
107 0.73
108 0.72
109 0.66
110 0.61
111 0.54
112 0.5
113 0.48
114 0.43
115 0.36
116 0.34
117 0.32
118 0.28
119 0.27
120 0.22
121 0.2
122 0.19
123 0.21
124 0.18
125 0.21
126 0.22
127 0.26
128 0.26
129 0.27
130 0.3
131 0.32
132 0.38
133 0.35
134 0.34
135 0.35
136 0.37
137 0.37
138 0.35
139 0.29
140 0.21
141 0.23
142 0.26
143 0.3
144 0.33
145 0.36
146 0.36
147 0.41
148 0.44
149 0.42
150 0.41
151 0.33
152 0.27
153 0.24
154 0.23
155 0.18
156 0.14
157 0.13