Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9K240

Protein Details
Accession A0A5M9K240    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
27-50KLKIEMKKTKLERKEKKRKLLLVHBasic
NLS Segment(s)
PositionSequence
27-45KLKIEMKKTKLERKEKKRK
Subcellular Location(s) mito 5, plas 5, nucl 4.5, cyto_nucl 4, E.R. 4, pero 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MDLEAQVQEKASGMLGGGSFLHKSISKLKIEMKKTKLERKEKKRKLLLVHITLDFLPWCFLIKHRIPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.06
5 0.07
6 0.07
7 0.07
8 0.08
9 0.08
10 0.1
11 0.17
12 0.22
13 0.22
14 0.24
15 0.32
16 0.37
17 0.43
18 0.49
19 0.46
20 0.49
21 0.54
22 0.6
23 0.62
24 0.65
25 0.69
26 0.73
27 0.8
28 0.81
29 0.85
30 0.85
31 0.83
32 0.79
33 0.79
34 0.76
35 0.71
36 0.66
37 0.56
38 0.49
39 0.42
40 0.36
41 0.26
42 0.17
43 0.12
44 0.09
45 0.1
46 0.1
47 0.12
48 0.2