Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JE13

Protein Details
Accession A0A5M9JE13    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-27ASPRLLGKEKLRRRKTGVRSQDEHydrophilic
NLS Segment(s)
PositionSequence
14-19KLRRRK
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
Amino Acid Sequences MVFLASPRLLGKEKLRRRKTGVRSQDEGTARQHQQSTNKHLQIYCQGSPALSDILTDLTTPHCVVQNCNHDSSRLKAWIGGVDYGCDWLGAKIDALCVCCTEVLTGALDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.65
3 0.68
4 0.74
5 0.8
6 0.8
7 0.81
8 0.81
9 0.78
10 0.74
11 0.69
12 0.68
13 0.6
14 0.52
15 0.45
16 0.42
17 0.36
18 0.35
19 0.35
20 0.31
21 0.37
22 0.42
23 0.47
24 0.48
25 0.49
26 0.48
27 0.46
28 0.45
29 0.44
30 0.42
31 0.34
32 0.27
33 0.24
34 0.22
35 0.22
36 0.2
37 0.13
38 0.07
39 0.07
40 0.05
41 0.06
42 0.06
43 0.06
44 0.05
45 0.05
46 0.06
47 0.07
48 0.07
49 0.1
50 0.1
51 0.12
52 0.19
53 0.27
54 0.29
55 0.31
56 0.31
57 0.3
58 0.31
59 0.32
60 0.3
61 0.24
62 0.22
63 0.2
64 0.21
65 0.22
66 0.22
67 0.21
68 0.16
69 0.14
70 0.14
71 0.14
72 0.13
73 0.1
74 0.09
75 0.06
76 0.08
77 0.07
78 0.08
79 0.07
80 0.1
81 0.12
82 0.13
83 0.14
84 0.13
85 0.13
86 0.13
87 0.13
88 0.11
89 0.11
90 0.1
91 0.11