Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JUW1

Protein Details
Accession A0A5M9JUW1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MASAKRKPSRRTSRRSIVSTHHydrophilic
NLS Segment(s)
PositionSequence
6-11RKPSRR
Subcellular Location(s) mito 20.5, cyto_mito 13.333, cyto 5, cyto_nucl 3.833
Family & Domain DBs
Amino Acid Sequences MASAKRKPSRRTSRRSIVSTHAPLVGDIEKGDINGSSDEVDESIATLKLAAESVTVRVLRETADEQARVITVMRSTIDAKDLKIQKLYRRLRDVTRELEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.74
4 0.7
5 0.68
6 0.62
7 0.54
8 0.45
9 0.36
10 0.32
11 0.3
12 0.24
13 0.15
14 0.12
15 0.11
16 0.09
17 0.09
18 0.09
19 0.07
20 0.07
21 0.07
22 0.08
23 0.07
24 0.07
25 0.07
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.07
47 0.09
48 0.1
49 0.12
50 0.14
51 0.14
52 0.14
53 0.14
54 0.14
55 0.12
56 0.12
57 0.09
58 0.06
59 0.08
60 0.08
61 0.1
62 0.11
63 0.12
64 0.16
65 0.16
66 0.17
67 0.24
68 0.29
69 0.29
70 0.35
71 0.39
72 0.42
73 0.52
74 0.6
75 0.6
76 0.64
77 0.66
78 0.68
79 0.73
80 0.72