Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JW11

Protein Details
Accession A0A5M9JW11    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-62GFCIIFNGRRRRRRILRQHQLDTGYHydrophilic
NLS Segment(s)
PositionSequence
47-51RRRRR
Subcellular Location(s) extr 9, mito 7, plas 7, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTSPTPTAVAGKAYPGLSLNGRIGVAVGIIVLALFITGFCIIFNGRRRRRRILRQHQLDTGYAAWKKRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.15
4 0.14
5 0.16
6 0.15
7 0.13
8 0.13
9 0.12
10 0.11
11 0.09
12 0.07
13 0.05
14 0.04
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.01
21 0.01
22 0.01
23 0.02
24 0.02
25 0.03
26 0.03
27 0.04
28 0.04
29 0.1
30 0.19
31 0.29
32 0.38
33 0.46
34 0.53
35 0.63
36 0.73
37 0.78
38 0.82
39 0.83
40 0.85
41 0.87
42 0.86
43 0.81
44 0.74
45 0.63
46 0.55
47 0.45
48 0.4
49 0.34