Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JFL8

Protein Details
Accession A0A5M9JFL8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-77YVLTNKVDNDKPKRKRKRKRLCMYDDRKTSASHydrophilic
NLS Segment(s)
PositionSequence
56-65KPKRKRKRKR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MQKQKSAESSINHKITPIPCSYQSAAPYHKDVKVSESSTNPSSMSYVLTNKVDNDKPKRKRKRKRLCMYDDRKTSASGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.37
4 0.33
5 0.28
6 0.26
7 0.31
8 0.33
9 0.31
10 0.32
11 0.32
12 0.31
13 0.29
14 0.32
15 0.3
16 0.3
17 0.28
18 0.26
19 0.26
20 0.27
21 0.27
22 0.25
23 0.24
24 0.25
25 0.24
26 0.25
27 0.2
28 0.16
29 0.14
30 0.12
31 0.11
32 0.1
33 0.1
34 0.12
35 0.13
36 0.14
37 0.14
38 0.19
39 0.22
40 0.29
41 0.37
42 0.45
43 0.54
44 0.65
45 0.75
46 0.81
47 0.88
48 0.92
49 0.93
50 0.94
51 0.95
52 0.96
53 0.95
54 0.95
55 0.93
56 0.92
57 0.87
58 0.82
59 0.72