Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JJI2

Protein Details
Accession A0A5M9JJI2   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
305-337HSPEHPRPWRHGPLRRRHHVPRRTRTPLPGHYSBasic
NLS Segment(s)
PositionSequence
310-328PRPWRHGPLRRRHHVPRRT
Subcellular Location(s) cyto 5, extr 1, mito 12, nucl 7, pero 1, plas 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR020845  AMP-binding_CS  
IPR000873  AMP-dep_Synth/Lig_com  
IPR042099  ANL_N_sf  
Pfam View protein in Pfam  
PF00501  AMP-binding  
PROSITE View protein in PROSITE  
PS00455  AMP_BINDING  
Amino Acid Sequences MGMGGLRGARIWRRGLLTESYCVGAVEPPLLPHTIPEHFRSIVQAHGSNFALVSHAQKTKLTYRELDERSNVIACGLRDLGVGKGDRVAVSLGNGWEFGAITYAIWKLGAVLVPLNPAFNTKQVESALDHLEASHLIIGRETPLPFKPPRDNTPLLKDIIGDLTQAEWRSETVPSLKKIILVNTSESGEFAGFASTTPFRDLIHGHESQREKEVIPNERLHRDDVISIQFTSGTTSRPKAACLSHHSILNNAHFIGSRMALTPSDIVCCPPPLFHCFGSVLGYMATATHGSTILFPSPAFDPRSHSPEHPRPWRHGPLRRRHHVPRRTRTPLPGHYSSNRLLNPPHGHRVRVLGSEILDGKDFIVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.41
4 0.39
5 0.38
6 0.36
7 0.33
8 0.29
9 0.26
10 0.22
11 0.16
12 0.14
13 0.13
14 0.12
15 0.12
16 0.13
17 0.14
18 0.13
19 0.13
20 0.17
21 0.21
22 0.23
23 0.26
24 0.29
25 0.29
26 0.3
27 0.32
28 0.29
29 0.27
30 0.28
31 0.28
32 0.25
33 0.28
34 0.28
35 0.24
36 0.23
37 0.18
38 0.15
39 0.13
40 0.15
41 0.16
42 0.19
43 0.2
44 0.22
45 0.26
46 0.33
47 0.38
48 0.38
49 0.36
50 0.39
51 0.48
52 0.5
53 0.49
54 0.44
55 0.4
56 0.38
57 0.36
58 0.3
59 0.21
60 0.2
61 0.16
62 0.16
63 0.15
64 0.13
65 0.12
66 0.13
67 0.13
68 0.14
69 0.14
70 0.11
71 0.13
72 0.13
73 0.13
74 0.13
75 0.12
76 0.09
77 0.09
78 0.12
79 0.1
80 0.1
81 0.1
82 0.09
83 0.08
84 0.08
85 0.07
86 0.06
87 0.05
88 0.05
89 0.06
90 0.07
91 0.06
92 0.06
93 0.06
94 0.05
95 0.07
96 0.07
97 0.06
98 0.07
99 0.07
100 0.09
101 0.1
102 0.1
103 0.08
104 0.1
105 0.11
106 0.13
107 0.16
108 0.15
109 0.18
110 0.18
111 0.19
112 0.18
113 0.2
114 0.18
115 0.16
116 0.15
117 0.12
118 0.12
119 0.1
120 0.09
121 0.08
122 0.07
123 0.06
124 0.06
125 0.07
126 0.08
127 0.11
128 0.11
129 0.11
130 0.12
131 0.17
132 0.19
133 0.24
134 0.3
135 0.34
136 0.39
137 0.44
138 0.48
139 0.46
140 0.51
141 0.49
142 0.42
143 0.36
144 0.31
145 0.23
146 0.21
147 0.17
148 0.1
149 0.07
150 0.07
151 0.08
152 0.09
153 0.08
154 0.07
155 0.07
156 0.08
157 0.08
158 0.09
159 0.13
160 0.16
161 0.17
162 0.2
163 0.19
164 0.21
165 0.22
166 0.23
167 0.21
168 0.18
169 0.19
170 0.17
171 0.18
172 0.15
173 0.14
174 0.12
175 0.08
176 0.07
177 0.06
178 0.05
179 0.04
180 0.04
181 0.06
182 0.06
183 0.07
184 0.08
185 0.08
186 0.08
187 0.1
188 0.11
189 0.13
190 0.17
191 0.19
192 0.19
193 0.25
194 0.26
195 0.26
196 0.28
197 0.25
198 0.2
199 0.22
200 0.27
201 0.27
202 0.3
203 0.34
204 0.35
205 0.38
206 0.38
207 0.36
208 0.31
209 0.26
210 0.23
211 0.2
212 0.19
213 0.16
214 0.15
215 0.13
216 0.12
217 0.11
218 0.13
219 0.11
220 0.11
221 0.12
222 0.14
223 0.19
224 0.19
225 0.2
226 0.21
227 0.23
228 0.26
229 0.31
230 0.37
231 0.34
232 0.37
233 0.36
234 0.35
235 0.36
236 0.33
237 0.27
238 0.2
239 0.18
240 0.15
241 0.16
242 0.15
243 0.11
244 0.1
245 0.1
246 0.11
247 0.1
248 0.11
249 0.12
250 0.11
251 0.12
252 0.12
253 0.12
254 0.13
255 0.15
256 0.14
257 0.14
258 0.17
259 0.19
260 0.23
261 0.22
262 0.23
263 0.22
264 0.23
265 0.24
266 0.21
267 0.17
268 0.13
269 0.12
270 0.09
271 0.08
272 0.08
273 0.05
274 0.05
275 0.05
276 0.06
277 0.06
278 0.07
279 0.09
280 0.1
281 0.1
282 0.1
283 0.11
284 0.13
285 0.17
286 0.19
287 0.18
288 0.23
289 0.28
290 0.33
291 0.34
292 0.37
293 0.42
294 0.49
295 0.59
296 0.62
297 0.62
298 0.65
299 0.71
300 0.77
301 0.76
302 0.76
303 0.77
304 0.77
305 0.83
306 0.85
307 0.85
308 0.85
309 0.86
310 0.86
311 0.87
312 0.87
313 0.87
314 0.86
315 0.84
316 0.82
317 0.81
318 0.8
319 0.77
320 0.72
321 0.68
322 0.64
323 0.63
324 0.58
325 0.55
326 0.48
327 0.43
328 0.4
329 0.42
330 0.47
331 0.48
332 0.55
333 0.51
334 0.51
335 0.5
336 0.54
337 0.49
338 0.44
339 0.4
340 0.32
341 0.3
342 0.32
343 0.32
344 0.26
345 0.23
346 0.2